Recombinant Salmonella heidelberg Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mscL; SeHA_C3714; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can recombinant Salmonella Heidelberg MscL be expressed and purified for structural and functional studies?

    Based on established protocols for other MscL homologs, a methodological approach for expression and purification of recombinant Salmonella Heidelberg MscL would include:

    Expression System:

    • Clone the full-length MscL gene from Salmonella Heidelberg into an expression vector with an N-terminal His-tag

    • Transform into E. coli expression strain (commonly BL21(DE3))

    • Induce expression with IPTG at optimal temperature (typically 18-25°C to minimize inclusion body formation)

    Purification Protocol:

    • Harvest cells and lyse using mechanical disruption

    • Solubilize membrane proteins using appropriate detergent (n-dodecyl-β-D-maltopyranoside is commonly used)

    • Perform immobilized metal affinity chromatography (IMAC) using the His-tag

    • Further purify by size exclusion chromatography to ensure homogeneity

    • Concentrate to 0.1-1.0 mg/mL in appropriate buffer containing detergent

    Storage Considerations:

    • Store in buffer containing 5-50% glycerol

    • Aliquot and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    For structural studies, protein quality can be verified using circular dichroism, dynamic light scattering, and analytical ultracentrifugation before attempting crystallization or other structural determination methods.

  • What experimental approaches are optimal for characterizing the electrophysiological properties of MscL channels?

    Several complementary techniques are used to characterize MscL channel electrophysiology:

    Patch-clamp Electrophysiology:

    • Giant spheroplast preparation: This technique allows for direct measurement of single-channel currents in response to membrane tension in a native-like environment.

    • Methodology: Apply suction pressure to patch pipette containing spheroplast membrane, then measure conductance and gating characteristics at different pressure levels .

    • Data analysis: Determine conductance (∼3 nS for MscL), pressure threshold for activation, and channel kinetics.

    Reconstitution into Liposomes:

    • Purified MscL can be reconstituted into azolectin liposomes for controlled studies.

    • This system demonstrates that MscL is gated solely by tension in the membrane lipid bilayer .

    • The tension required to gate MscL (∼10-12 mN m⁻¹) can be precisely measured.

    Planar Lipid Bilayer Recordings:

    • Allows for controlled manipulation of membrane composition and tension.

    • Useful for studying the effects of lipid environment on channel properties.

    Fluorescence-based Assays:

    • Use fluorescent dyes that are released through the channel upon activation.

    • Enables high-throughput screening of channel activity under different conditions.

    Recent research has also employed engineered MscL channels for mechano-sensitization of mammalian neuronal networks, demonstrating the versatility of these experimental approaches .

  • How do genetic variations in MscL affect Salmonella Heidelberg virulence and pathogenicity?

    While direct research on MscL's role in Salmonella Heidelberg virulence is limited in the search results, we can draw insights from related studies:

    Strain Variability and Virulence:

    • Salmonella Heidelberg variants with distinct pulse-field gel electrophoresis (PFGE) patterns have shown significant differences in morbidity and mortality during outbreaks .

    • For example, strain SX 245 with PFGE pattern JF6X01.0523 was identified as highly pathogenic, causing 25-65% mortality in dairy beef calves, while strain SX 244 with PFGE pattern JF6X01.0590 caused considerably fewer deaths .

    Genomic Comparison Results:

    • Genomic analysis revealed that the more pathogenic strain (SX 245) lacked ~200 genes present in the less pathogenic strain (SX 244), but also contained 8 unique genes not found in SX 244 .

    • While MscL variations were not specifically highlighted in this comparative analysis, the study demonstrated that genomic differences significantly impact virulence.

    RNA-Sequencing Data:

    • Differential gene expression analysis showed that the more pathogenic strain had upregulated fimbriae-related, flagella-related, and chemotaxis genes .

    • These pathways are critical for bacterial adhesion, motility, and invasion of host cells.

    Cellular Invasion Assays:

    • The more pathogenic strain showed significantly higher invasion rates in both human and bovine epithelial cells .

    • Specifically, SX 245 had >2-fold higher invasion in human cells and >7-fold higher invasion in bovine cells compared to SX 244.

    These findings suggest that while MscL itself may not be directly implicated in virulence differences between Salmonella Heidelberg strains, it operates within a complex genomic context where multiple factors contribute to pathogenicity. Future research specifically examining MscL mutations in Salmonella Heidelberg could reveal whether this channel plays a direct role in virulence modulation.

  • What structural changes occur during MscL gating, and how can these be experimentally captured?

    The gating mechanism of MscL involves substantial conformational changes that transform the channel from a closed to an open state:

    Structural Transitions During Gating:

    • In the closed state, the pore is constricted by hydrophobic residues (e.g., Leu19 and Val23 in EcMscL) .

    • Upon membrane tension increase, the channel undergoes an iris-like expansion.

    • TM1 and TM2 helices exhibit significant changes in tilt angles that fit the helix-pivoting model .

    • The pore expands from nearly closed to approximately 25-30 Å in diameter .

    • The periplasmic loop region transforms from a folded structure to an expanded state .

    Experimental Approaches to Capture Structural Changes:

    1. X-ray Crystallography with Fusion-Protein Strategy:

      • As demonstrated for M. acetivorans MscL, this approach successfully captured both closed and expanded intermediate states .

      • The strategy involves applying fusion-protein techniques and controlling detergent composition.

      • This revealed conformational rearrangements in different domains of MscL and significant changes in the tilt angles of TM1 and TM2 helices .

    2. Electron Paramagnetic Resonance (EPR) Spectroscopy:

      • Site-directed spin labeling combined with EPR can track movement of specific residues during gating.

      • This technique has provided evidence for the iris-like expansion model of MscL gating.

    3. Molecular Dynamics Simulations:

      • Computational approaches can model the complete gating transition when combined with experimental constraints.

      • Simulations have suggested intermediate states during the transition from closed to open.

    4. Fluorescence Resonance Energy Transfer (FRET):

      • Strategic placement of fluorophores can monitor distances between moving parts of the channel during gating.

      • This approach has been used to validate proposed gating models.

    5. Cryo-Electron Microscopy (cryo-EM):

      • Modern cryo-EM techniques could potentially capture MscL in different conformational states.

      • This might overcome limitations of crystallizing membrane proteins in specific states.

    The collective data from these complementary approaches has led to the current understanding of MscL as undergoing an iris-like expansion during gating, with the channel transitioning through multiple subconducting states before reaching the fully open configuration.

  • How can MscL be engineered for specific research applications and what modifications affect channel function?

    MscL channels can be engineered in various ways for research applications:

    Site-Directed Mutagenesis Approaches:

    1. Tension Sensitivity Modification:

      • The hydrophobicity of pore-lining residues can be altered to change gating tension threshold.

      • Substitution of glycine for the hydrophobic constriction residues creates channels that gate at lower membrane tensions.

      • This approach has been used to create MscL variants that are more sensitive to membrane stretch for biotechnological applications .

    2. Conductance Alteration:

      • Mutations in the pore-lining residues can modify channel conductance.

      • The C-terminal domain truncation studies showed that removing this domain affects conductance properties, as demonstrated in M. tuberculosis MscL (MtMscLΔC) .

      • Electrophysiological characterization revealed that MtMscLΔC retains mechanosensitivity but with conductance and tension sensitivity more closely resembling EcMscL than MtMscL .

    3. Ligand-Gated MscL Variants:

      • Introduction of cysteine residues at strategic positions allows for chemical modification.

      • This creates MscL channels that can be activated by specific chemical stimuli rather than merely membrane tension.

      • Such engineered channels have applications in controlled release systems.

    Applications in Neuroscience Research:

    The development of mechano-sensitized neuronal networks through heterologous expression of engineered MscL has been reported . This approach enables:

    • Remote mechanical stimulation of neuronal tissues

    • Cell-type-specific stimulation approaches

    • Development of mechano-genetic techniques for neuroscience research

    The study validated neuronal functional expression of MscL through patch-clamp recordings upon application of calibrated suction pressures and verified network development in terms of cell survival, number of synaptic puncta, and spontaneous network activity .

    Structural Considerations for Engineering:

    When engineering MscL variants, researchers should consider:

    • The pentameric architecture and symmetry requirements

    • The role of the transmembrane helices in sensing membrane tension

    • The contribution of the C-terminal domain to channel stability and function

    • The potential impact of modifications on oligomeric assembly

    The collective evidence suggests that MscL is a versatile platform for protein engineering with applications spanning from basic research to potential biotechnological innovations.

  • How does MscL structure and function in Salmonella Heidelberg compare to MscL in other Salmonella serovars, and what are the implications for pathogenicity?

    While the search results don't provide direct comparative data specifically for MscL across different Salmonella serovars, we can analyze the available information to draw some insights:

    Sequence Conservation in Salmonella Serovars:

    Based on the amino acid sequence provided for Salmonella Enteritidis PT4 MscL (137 amino acids) , we can infer that MscL is likely highly conserved across Salmonella serovars, given the general conservation pattern observed in other bacterial species. The sequence from Salmonella Enteritidis PT4 can serve as a reference point for comparison with Salmonella Heidelberg MscL.

    Pathogenicity Comparison Across Salmonella Serovars:

    1. Invasion Properties:

      • Studies comparing invasion in bovine epithelial cells (MDBK) showed that host-adapted serovars Salmonella Dublin and Salmonella Enteritidis have invasion rates of approximately 75% and 73% respectively .

      • These rates are higher than those observed for Salmonella Heidelberg strains in similar assays .

      • Invasion rates vary between strains within the same serovar, suggesting strain-dependent factors beyond serovar classification.

    2. Outbreak Characteristics:

      • Salmonella Heidelberg has caused several multistate foodborne outbreaks in the United States, largely associated with poultry consumption .

      • A 2015-2017 multidrug-resistant Salmonella Heidelberg outbreak was linked to dairy beef calves, showing host range expansion .

      • Salmonella Heidelberg outbreaks in Australia (2018-2019) showed a hospitalization rate of 36%, suggesting a "moderately severe clinical picture" .

      • Salmonella Heidelberg is a frequently identified serotype in North America, East Africa, and Asia but is uncommon in Australia, which typically reports an average of 37 cases annually (2009-2017) .

    3. Genomic Diversity:

      • Salmonella Heidelberg isolates demonstrate large genetic diversity, with significant PFGE pattern differences .

      • This genetic variation may provide selective advantage, particularly during times of environmental stress .

      • Altered gene expression patterns can convey the ability to withstand stressful conditions such as heat extremes and host immune responses .

    Research Considerations:

    When studying MscL in Salmonella Heidelberg compared to other serovars, researchers should consider:

    • Utilizing comparative genomics to identify any serovar-specific variations in the MscL sequence

    • Examining expression levels of MscL under different environmental conditions relevant to each serovar's typical infection cycle

    • Conducting electrophysiological characterization to determine if MscL gating properties differ between serovars

    • Creating MscL knockout strains in different serovars to assess the relative importance of this channel in various host environments

    A comprehensive study comparing MscL structure, function, and regulation across multiple Salmonella serovars could provide valuable insights into the role of this mechanosensitive channel in Salmonella pathogenicity and host adaptation.

  • What are the most effective approaches for inhibiting Salmonella Heidelberg colonization, and could MscL be a potential target?

    Research suggests several approaches for inhibiting Salmonella Heidelberg colonization, with potential implications for MscL as a target:

    Probiotic-Based Approaches:

    1. Lactobacillus Strains:

      • Lactobacillus bulgaricus, Lactobacillus rhamnosus, and Lactobacillus paracasei have demonstrated effectiveness in attenuating Salmonella Heidelberg colonization and virulence gene expression in vitro .

      • These probiotics likely function through multiple mechanisms, including competitive exclusion, production of antimicrobial compounds, and modulation of host immune responses.

    2. Cell Invasion Inhibition:

      • Probiotic interventions have shown the ability to reduce Salmonella invasion of epithelial cells, a crucial step in pathogenesis .

      • This suggests that targeting adhesion and invasion mechanisms could be effective strategies.

    Antimicrobial Resistance Considerations:

    • Recent Salmonella Heidelberg isolates have demonstrated a broadened resistance profile compared with earlier isolates .

    • MDR Salmonella Heidelberg often carries resistance genes on IncC plasmids .

    • The prevalence of MDR in Salmonella has increased over time, making severe salmonellosis increasingly difficult to treat with empirical antimicrobials .

    • Resistance has been associated with elevated virulence, possibly due to coselection of virulence traits with resistance mechanisms .

    MscL as a Potential Target:

    While MscL hasn't been specifically studied as an antimicrobial target in Salmonella Heidelberg based on the search results, several features make it a potentially interesting candidate:

    1. Essential Function:

      • MscL serves as a critical emergency release valve during osmotic downshock, a condition bacteria might encounter during infection.

      • Disrupting MscL function could potentially leave bacteria vulnerable to osmotic stress during infection.

    2. Conserved Structure:

      • The high conservation of MscL across bacterial species suggests its essential nature.

      • Structural differences between bacterial and eukaryotic mechanosensitive channels could potentially allow for selective targeting.

    3. Surface Accessibility:

      • As a transmembrane protein, portions of MscL are exposed to the extracellular environment.

      • This accessibility could facilitate binding of potential inhibitors.

    4. Experimental Approaches:

      • Develop small molecule inhibitors that either block the channel in its closed state or force it to remain open, disrupting osmotic regulation.

      • Create peptides that mimic interacting regions of MscL subunits to interfere with proper channel assembly.

      • Design compounds that alter membrane fluidity in a way that specifically affects MscL gating.

    Research Challenges:

    Several challenges exist in developing MscL-targeting approaches:

    • Ensuring specificity for bacterial MscL over eukaryotic mechanosensitive channels

    • Achieving adequate penetration through the bacterial outer membrane (particularly challenging for Gram-negative bacteria)

    • Preventing rapid development of resistance

    • Validating the essentiality of MscL under infection-relevant conditions

    Future research directions could include high-throughput screening for MscL inhibitors, structural studies of MscL in complex with candidate inhibitors, and in vivo validation of MscL targeting approaches in animal infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.