Recombinant Salmonella heidelberg Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biological Significance

Lipoprotein signal peptidase (LspA) is a type II signal peptidase essential for processing bacterial lipoproteins. In Salmonella Heidelberg, LspA cleaves the N-terminal signal peptide of prolipoproteins, enabling their maturation and integration into the bacterial membrane. This enzymatic activity is critical for bacterial virulence, host cell invasion, and resistance to host immune defenses .

Key features of LspA:

  • Catalytic Mechanism: Functions as an aspartyl protease with conserved domains for substrate recognition and cleavage .

  • Substrate Specificity: Processes lipoproteins involved in nutrient acquisition, membrane stability, and antibiotic resistance .

  • Essentiality: Gene knockout studies in Rickettsia typhi (a related pathogen) confirm that LspA is indispensable for intracellular survival .

Functional Validation and Assays

Recombinant LspA has been validated through:

  • Globomycin Resistance Assays: Overexpression in E. coli confers resistance to globomycin, a specific LspA inhibitor, confirming enzymatic activity .

  • Genetic Complementation: Partially restores growth in E. coli temperature-sensitive mutants lacking functional LspA, demonstrating cross-species functionality .

Table 1: Functional Comparison of Salmonella Heidelberg LspA vs. E. coli LspA

ParameterSalmonella Heidelberg LspAE. coli LspA
Globomycin Resistance25–200 μg/ml 25–200 μg/ml
Complementation Efficiency20% restoration 100%
Sequence Identity22% Reference

Applications in Vaccine Development

Recombinant LspA is explored in vaccine design due to its role in bacterial survival:

  • Antigen Delivery Systems: Attenuated Salmonella strains with regulated lysis systems (e.g., χ8937) deliver heterologous antigens (e.g., pneumococcal PspA) to host tissues, leveraging LspA’s role in lipoprotein processing .

  • Immune Response Modulation: Recombinant Salmonella vaccines expressing LspA-related antigens induce mixed Th1/Th2 immune responses, enhancing protection against pathogens like Streptococcus pneumoniae .

Table 2: Immune Response to Salmonella-Delivered Antigens

AntigenIgG Subclass (Th1/Th2 Ratio)Protection Efficacy
rPspAIgG2a/IgG1 = 1:1 60% survival
SOMPsIgG2a-dominant 100% survival

Role in Antimicrobial Resistance (AMR)

LspA-linked pathways contribute to AMR in Salmonella Heidelberg:

  • Plasmid-Mediated Resistance: Strains carrying IncI1 or IncC plasmids (harboring blaCMY-2 or blaTEM-1B) exhibit prolonged survival in poultry litter, correlating with LspA activity .

  • Col Plasmid Enrichment: High copy numbers of ColpVC plasmids enhance persistence in low-water-activity environments .

Table 3: AMR Genes Co-Occurring with LspA in Salmonella Heidelberg

GeneResistance ProfilePlasmid Type
blaCMY-2Ampicillin, ceftriaxoneIncI1
floRChloramphenicol, florfenicolIncC
tet(A)TetracyclineIncC

Biotechnological Production Challenges

  • Low Activity: Recombinant Salmonella LspA exhibits 5-fold lower complementation efficiency than E. coli LspA, likely due to structural divergence .

  • Stability Issues: Requires glycerol-based storage buffers to retain activity, limiting long-term applications .

Future Directions

  • Therapeutic Targeting: LspA’s conformational dynamics (e.g., periplasmic helix flexibility) offer avenues for designing globomycin analogs .

  • Pathogen Containment: Engineered Salmonella strains with LspA-dependent lysis systems could enable biological containment in vaccine platforms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
lspA; SeHA_C0050; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
lspA
Target Protein Sequence
MSKPLCSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVGLFPSLNLHYARNYGAAFSF LADSGGWQRWFFAGIAIGICVILLVMMYRSKATQKLNNIAYALIIGGALGNLFDRLWHGF VVDMIDFYVGNWHFATFNLADSAICIGAALIVLEGFLPKPTAKEQA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) and what is its function in Salmonella heidelberg?

Lipoprotein signal peptidase (lspA) encodes the type II signal peptidase (SPase II), which is an essential component of lipoprotein processing in gram-negative bacteria including Salmonella heidelberg. This enzyme is responsible for cleaving signal peptides from prolipoproteins after lipid modification, which is a critical step in bacterial membrane biogenesis. The lspA gene produces SPase II that specifically recognizes and processes bacterial lipoproteins, facilitating their proper localization to the bacterial membrane. In Salmonella species, as in other gram-negative bacteria, this processing is vital for maintaining membrane integrity, cellular survival, and pathogenesis .

How does lspA gene expression change during different phases of Salmonella infection?

The expression of lspA, like other genes involved in bacterial protein processing and secretion, follows a differential pattern during various stages of bacterial intracellular growth. Based on research in related bacteria, lspA typically shows higher expression levels at the pre-infection stage, suggesting that metabolically active bacteria require robust lipoprotein processing machinery before host cell invasion. During intracellular growth phases, the expression pattern may fluctuate depending on the bacterial needs for membrane remodeling and adaptation to the host environment. The expression of lspA often correlates with that of lgt (prolipoprotein transferase), as both are involved in sequential steps of lipoprotein processing .

How does lspA contribute to Salmonella pathogenesis and survival?

The lspA gene product is critical for proper processing of lipoproteins that contribute to bacterial survival, virulence, and persistence. In Salmonella, properly processed lipoproteins are essential for:

Research indicates that bacteria with functional lipoprotein processing machinery can better persist in challenging environments. For example, specific Salmonella strains with certain genetic elements (including plasmids that may affect lipoprotein processing) have demonstrated enhanced survival in environmental conditions such as poultry bedding materials .

What are the most effective methods for cloning and expressing recombinant Salmonella heidelberg lspA?

Successful cloning and expression of recombinant Salmonella heidelberg lspA requires careful consideration of multiple factors:

Vector Selection:

  • pET expression systems often yield high expression levels for bacterial proteins

  • pGEX vectors may be useful when GST-tagged fusion proteins are desired for enhanced solubility

  • pBAD vectors offer the advantage of tightly regulated, arabinose-inducible expression

Host Strain Considerations:

  • E. coli BL21(DE3) strains are generally preferred for their reduced protease activity

  • C41/C43 strains may be better suited for membrane protein expression

  • Complementation studies can be performed in temperature-sensitive E. coli strains (such as Y815) to validate lspA function

Expression Optimization Protocol:

  • Culture bacteria at 30°C rather than 37°C to reduce inclusion body formation

  • Use lower inducer concentrations (0.1-0.5 mM IPTG instead of 1 mM)

  • Include membrane-mimicking detergents during protein extraction

  • Implement a stepwise purification approach using affinity chromatography followed by size exclusion chromatography

How can researchers assess the functional activity of recombinant lspA?

The functional activity of recombinant lspA can be assessed through multiple complementary approaches:

Globomycin Resistance Assay:
Recombinant lspA expression in E. coli confers increased resistance to globomycin, a specific inhibitor of SPase II. The minimum inhibitory concentration (MIC) of globomycin can be determined for strains expressing recombinant lspA compared to control strains .

Genetic Complementation:
Temperature-sensitive E. coli mutants with defective lspA (such as E. coli Y815) can be transformed with recombinant Salmonella heidelberg lspA. Restoration of growth at the non-permissive temperature indicates functional activity of the recombinant protein .

In Vitro Enzyme Activity Assay:

  • Purify recombinant lspA protein with intact catalytic domains

  • Prepare fluorogenic peptide substrates mimicking the signal peptide cleavage site

  • Measure the rate of substrate cleavage spectrofluorometrically

  • Calculate enzyme kinetic parameters (Km, Vmax)

What experimental approaches are most effective for studying lspA expression during infection?

Real-Time Quantitative RT-PCR:
This method allows precise monitoring of lspA transcription during different stages of infection. Key considerations include:

  • Careful design of primers specific to Salmonella heidelberg lspA

  • Selection of appropriate reference genes that remain stable during infection

  • Extraction of RNA at critical timepoints (pre-infection, early, mid, and late infection stages)

  • Use of appropriate normalization methods for accurate quantification

Reporter Gene Fusions:

  • Construction of transcriptional fusions (lspA promoter fused to reporters like GFP or luciferase)

  • Integration of reporter constructs into the Salmonella genome

  • Monitoring expression dynamics during infection in real-time

  • Correlating expression with specific infection events

Proteomics Approaches:

  • Stable isotope labeling with amino acids in cell culture (SILAC)

  • Targeted mass spectrometry to quantify lspA protein levels

  • Comparison of protein abundance across infection timepoints

What is the potential of lspA as a target for Salmonella vaccine development?

The lspA gene product represents a promising target for Salmonella vaccine development for several reasons:

  • Essential Role: As a processor of bacterial lipoproteins, lspA is essential for bacterial viability and virulence

  • Surface Accessibility: The enzyme processes lipoproteins destined for the bacterial surface

  • Conserved Domains: Contains highly conserved catalytic residues that could be targeted by immune responses

When considering vaccine development strategies targeting lspA or its substrates, researchers should note that some recombinant Salmonella surface proteins have demonstrated promising immunogenicity profiles. For example, studies with recombinant Salmonella Heidelberg surface-exposed proteins showed that FliD and FlgK induced strong immunoglobulin responses (IgG, IgM, and IgA) in vaccinated chickens, while others like FimA and FimW showed less immunogenicity .

How can researchers optimize the immunogenicity of recombinant lspA-based vaccines?

Optimizing the immunogenicity of recombinant lspA-based vaccines requires addressing several key factors:

Antigen Design Considerations:

  • Include conserved epitopes that stimulate broad protection

  • Ensure proper protein folding to preserve conformational epitopes

  • Consider chimeric constructs that combine multiple antigens for enhanced immunogenicity

Adjuvant Selection:
Appropriate adjuvants can significantly enhance immune responses to recombinant protein vaccines. Based on studies with other Salmonella proteins, effective adjuvant options may include:

  • Aluminum hydroxide for enhanced antibody responses

  • Oil-in-water emulsions for balanced Th1/Th2 responses

  • TLR agonists for enhanced cellular immunity

Vaccination Protocol Optimization:
Based on studies with other recombinant Salmonella proteins, the following parameters should be considered:

  • Dose: Typically 50-100 μg of recombinant protein per dose

  • Schedule: Prime-boost regimens with 2-3 week intervals

  • Route: Subcutaneous or intramuscular administration frequently yields robust systemic immunity

Immune Response Monitoring:
Comprehensive assessment of vaccine-induced immunity should include:

  • Antibody responses: IgG, IgM, and IgA quantification via ELISA

  • Cellular immunity: T-cell proliferation and cytokine profiling

  • Functional assays: Bacterial growth inhibition or opsonophagocytic activity

What is the relationship between lspA function and antimicrobial resistance in Salmonella heidelberg?

The relationship between lspA function and antimicrobial resistance in Salmonella heidelberg is multifaceted:

Direct Mechanistic Connections:

  • Properly processed lipoproteins contribute to membrane integrity, potentially affecting drug permeability

  • Some lipoproteins may be involved in efflux pump assembly or regulation

  • Lipoproteins can modulate stress responses that influence antimicrobial susceptibility

Genetic Context Observations:
Certain Salmonella Heidelberg strains harbor antimicrobial resistance genes on plasmids that may co-regulate with genes involved in lipoprotein processing. For example, strains isolated from poultry sources have been found to carry resistance genes such as:

  • blaCMY-2 on IncI1 plasmids

  • Multiple resistance genes (floR, cmlA1, tet(A), blaTEM-1B, various aminoglycoside resistance genes, and sul2) on IncC plasmids

Persistence Phenotypes:
Salmonella Heidelberg strains harboring plasmids with antimicrobial resistance genes have demonstrated enhanced persistence in environmental conditions. For instance, strains carrying the AmpC-like beta-lactamase gene persisted longer in pine wood shavings even without antibiotic selection pressure, suggesting potential fitness advantages conferred by these genetic elements .

How can researchers study the impact of lspA inhibition on antimicrobial susceptibility?

Combination Therapy Approaches:

  • Determine MICs of antibiotics alone and in combination with SPase II inhibitors (e.g., globomycin)

  • Calculate fractional inhibitory concentration (FIC) indices to identify synergistic combinations

  • Perform time-kill assays to evaluate bactericidal activity of combination therapies

Genetic Modulation Strategies:

  • Construct conditional lspA mutants using inducible promoters

  • Titrate lspA expression levels and correlate with antibiotic susceptibility

  • Implement CRISPR interference (CRISPRi) for partial knockdown of lspA expression

Transcriptomic Analysis:

  • Compare gene expression profiles between lspA-inhibited and wild-type bacteria

  • Identify compensatory pathways activated upon lspA inhibition

  • Map changes in expression of known antibiotic resistance determinants

What are common challenges in purifying recombinant lspA and how can they be addressed?

Challenge 1: Protein Insolubility
As a membrane-associated protein, lspA often exhibits poor solubility when expressed recombinantly.

Solutions:

  • Express as fusion protein with solubility-enhancing tags (MBP, SUMO, or thioredoxin)

  • Optimize detergent selection (mild detergents like DDM or LDAO often work well)

  • Use stepwise extraction with increasing detergent concentrations

  • Consider membrane-mimicking systems (nanodiscs or amphipols) for purification

Challenge 2: Low Expression Levels

Solutions:

  • Optimize codon usage for expression host

  • Test multiple promoter systems (T7, tac, araBAD)

  • Reduce culture temperature to 16-25°C during induction

  • Consider auto-induction media for gradual protein expression

Challenge 3: Proteolytic Degradation

Solutions:

  • Use protease-deficient expression strains

  • Include protease inhibitor cocktails during all purification steps

  • Maintain samples at 4°C throughout processing

  • Consider shorter induction times with higher cell densities

How can researchers design experiments to investigate lspA interactions with other lipoprotein processing enzymes?

Co-immunoprecipitation Studies:

  • Generate antibodies against lspA or use epitope-tagged versions

  • Perform pull-down experiments to identify interacting partners

  • Confirm interactions with reciprocal co-immunoprecipitation

  • Validate physiological relevance with in vivo crosslinking

Bacterial Two-Hybrid Analysis:

  • Clone lspA and potential interacting proteins (e.g., lgt, lnt) into appropriate vectors

  • Transform into reporter strains and assay for protein-protein interactions

  • Quantify interaction strength through reporter gene expression

  • Perform domain mapping to identify specific interaction regions

Functional Coordination Assessment:

  • Create single and double mutants of lipoprotein processing genes

  • Compare phenotypic consequences of individual vs. combined mutations

  • Analyze the expression correlation between lspA and other processing genes during infection

  • Determine if expression patterns of lspA, lgt, and lepB show coordinated regulation as observed in other bacterial species

What quality control methods ensure proper folding and function of recombinant lspA?

Biophysical Characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate protein stability

  • Size exclusion chromatography to verify monodispersity

  • Dynamic light scattering to detect aggregation

Functional Validation:

  • Enzymatic activity assays using fluorogenic peptide substrates

  • Complementation of lspA-deficient bacterial strains

  • Globomycin binding assays (globomycin is a specific inhibitor of SPase II)

  • Mass spectrometry to confirm correct processing of model substrates

Table 1: Typical Quality Control Parameters for Recombinant lspA Preparation

ParameterMethodAcceptance Criteria
PuritySDS-PAGE>95% single band
IdentityWestern blotSingle band at expected MW
Secondary structureCircular dichroismα-helical content >40%
Thermal stabilityDifferential scanning fluorimetryTm ≥ 45°C
Enzymatic activityFluorogenic substrate assaySpecific activity ≥ 0.5 μmol/min/mg
HomogeneitySize exclusion chromatography>90% monodispersed
Endotoxin levelLAL assay<1 EU/mg protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.