Recombinant Salmonella heidelberg NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella heidelberg NADH-Quinone Oxidoreductase Subunit A (nuoA)

NADH-quinone oxidoreductase (NDH-1) is a proton-translocating enzyme in the bacterial respiratory chain, responsible for transferring electrons from NADH to quinones while generating a proton gradient . The nuoA gene encodes subunit A, a peripheral component of the hydrophilic domain of NDH-1 in Salmonella heidelberg. Recombinant nuoA is produced in E. coli and is widely used in structural, biochemical, and genetic studies .

2.2. Biological Role

  • Electron Transfer: Facilitates NADH oxidation and quinone reduction, linking redox reactions to proton translocation .

  • Proton Motive Force: Each NADH oxidation drives the translocation of 4 H⁺ ions across the membrane, enhancing ATP synthesis .

  • Regulatory Role: Mutations in nuoA disrupt NDH-1 assembly, impairing aerobic respiration .

3.2. Research Applications

  • Structural Studies: Crystallography and cryo-EM to resolve NDH-1 architecture .

  • Enzyme Activity Assays: Measurement of NADH-oxidase, NADH-DB (dichlorobenzoquinone), and NADH-K₃Fe(CN)₆ reductase activities .

  • Suppressor Mutation Analysis: Investigating mutations (e.g., nuoG(Q297K)) that rescue respiratory defects in ubiquinone-deficient mutants .

4.1. Suppressor Mutations in NDH-1 Subunits

Mutations in nuoG, nuoM, and nuoN restore motility and respiration in Salmonella strains lacking ubiquinone biosynthesis.

MutationSubunit DomainFunctional ImpactSource
nuoG(Q297K)HydrophilicEnhances electron transfer to demethylmenaquinone, rescuing NADH oxidation
nuoM(A254S)MembraneModifies proton translocation channels, improving quinone-binding efficiency
nuoN(A444E)MembraneStabilizes interactions between hydrophilic and membrane domains

These mutations increase NDH-1 protein levels (detected via immunoblotting) and partially restore oxygen consumption rates (~14–18% of wild-type) .

4.2. Quinone Pool Dynamics

In ubiA deletion mutants, the quinone pool shifts to demethylmenaquinone and menaquinone, with reduced ubiquinone levels. Suppressor mutations improve electron flow to alternative quinones .

Applications in Biotechnology and Diagnostics

  • ELISA Kits: Used to detect nuoA in bacterial lysates for diagnostic or research purposes .

  • Protein Engineering: Studying subunit interactions to design inhibitors or enhance respiratory efficiency .

  • Therapeutic Models: Insights into NDH-1 function inform strategies for treating mitochondrial disorders linked to complex I defects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SeHA_C2567; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NADH-quinone oxidoreductase complex in Salmonella heidelberg and where does nuoA fit in?

NADH-quinone oxidoreductase (Complex I) is a multi-subunit enzyme in the respiratory chain of Salmonella that couples electron transfer from NADH to quinones with proton translocation across the membrane. This complex plays a critical role in energy metabolism by contributing to the proton motive force used for ATP synthesis. The NuoA subunit is part of the membrane-embedded domain of the complex, contributing to the structural integrity of the proton-translocating module.

Similar studies in other bacteria have demonstrated that the NADH:quinone oxidoreductase complex can significantly influence bacterial metabolism and pathogenicity. For instance, in Vibrio cholerae, the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) plays a crucial role in sodium ion extrusion, which affects pathogenicity .

How does the role of nuoA differ from other Nuo subunits in the NADH-quinone oxidoreductase complex?

While NuoA is primarily involved in maintaining structural integrity in the membrane domain, other Nuo subunits have more direct roles in electron transfer or proton translocation. Based on studies of NADH:quinone oxidoreductase in Salmonella, we know that subunits like NuoG, NuoM, and NuoN are directly involved in electron flow and can even develop suppressor mutations that rescue motility in ubiquinone-biosynthesis mutants .

NuoG is part of the hydrophilic domain responsible for NADH binding and initial electron acceptance, while NuoM and NuoN are hydrophobic membrane-embedded subunits involved in proton translocation. Mutations in these subunits (NuoG(Q297K), NuoM(A254S), and NuoN(A444E)) have been shown to improve electron flow activity under certain conditions .

What are the optimal conditions for expressing recombinant Salmonella heidelberg nuoA?

Expression of recombinant NuoA requires specialized approaches due to its hydrophobic nature as a membrane protein. The recommended protocol includes:

  • Use of E. coli expression strains optimized for membrane proteins (C41(DE3) or C43(DE3))

  • Induction at lower temperatures (16-20°C) to minimize inclusion body formation

  • Reduced inducer concentrations (0.1-0.5 mM IPTG)

  • Growth in rich media supplemented with glucose to minimize basal expression

  • Addition of membrane-stabilizing agents like glycerol (5-10%)

The expression vector should include a fusion tag to assist in purification and potentially improve solubility. Based on similar approaches used for other bacterial membrane proteins, a C-terminal His6-tag or Strep-tag II often provides good results while minimally affecting protein function.

What purification strategy yields the highest purity and activity for recombinant nuoA?

A multi-step purification approach is recommended:

  • Membrane fraction isolation by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside at 1% w/v)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates and achieve high purity

  • Quality assessment by SDS-PAGE and Western blotting

This approach typically yields 0.5-2 mg of purified protein per liter of bacterial culture with >90% purity. The choice of detergent is crucial for maintaining activity; DDM has been successfully used in the purification of other Nuo subunits and related respiratory proteins.

How can researchers assess the structural integrity of purified recombinant nuoA?

Several complementary methods can be employed:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate protein stability

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Limited proteolysis to probe for properly folded conformation

  • Reconstitution into liposomes or nanodiscs for functional assays

It's essential to compare results with those from natively purified NADH:quinone oxidoreductase complex or membrane preparations from wild-type Salmonella heidelberg to establish benchmarks for properly folded and functional NuoA.

What methods can be used to study nuoA's role in quinone binding and electron transfer?

Several approaches can be used to investigate NuoA's involvement in quinone interactions:

  • Site-directed mutagenesis of conserved residues in transmembrane domains

  • Electron paramagnetic resonance (EPR) spectroscopy to detect semiquinone intermediates during catalysis

  • Activity assays measuring NADH oxidation coupled to quinone reduction with artificial electron acceptors

  • Comparative studies using different quinone substrates (ubiquinone, menaquinone, demethylmenaquinone)

  • Competitive inhibition studies with quinone analogs

EPR spectroscopy has been successfully used to detect organic radicals in membrane preparations during NADH oxidation. In Vibrio cholerae membranes, ubisemiquinone radicals were detected at concentrations of 0.2-0.4 mM, depending on sodium ion concentration . Similar approaches could be applied to study quinone interactions in Salmonella NADH:quinone oxidoreductase.

How do mutations in nuoA affect quinone reduction and respiratory function?

Based on studies of other Nuo subunits, mutations in NuoA likely impact:

  • The structural integrity of the membrane domain

  • The accessibility of quinone binding sites

  • The efficiency of electron transfer from the hydrophilic domain to quinones

  • The coupling between electron transfer and proton translocation

In Salmonella, mutations in NuoG, NuoM, and NuoN improved electron flow activity in ubiquinone-biosynthesis mutant strains . This suggests that mutations in the NADH:quinone oxidoreductase complex can adapt the enzyme to use alternative quinones when the primary electron acceptor is unavailable. Similar adaptive mutations might occur in NuoA to optimize quinone interactions under different environmental conditions.

Nuo Subunit MutationEffect on Electron FlowGrowth in LBUse of L-malate
NuoG(Q297K)ImprovedEnhancedRestored
NuoM(A254S)ImprovedEnhancedRestored
NuoN(A444E)ImprovedEnhancedRestored
Wild-typeBaselineNormalNormal
UbiA deletionReducedImpairedUnable

Table 1: Effects of suppressor mutations in Nuo subunits on electron flow and growth in a Salmonella ubiquinone-biosynthesis mutant .

What is the relationship between nuoA and radical formation during respiratory electron transfer?

Studies in related bacterial systems have shown that NADH:quinone oxidoreductase can generate organic radicals during electron transfer. In Vibrio cholerae, NADH reduction of the respiratory chain led to the formation of ubisemiquinone radicals detectable by EPR spectroscopy . The concentration of these radicals increased from 0.2 mM to 0.4 mM when sodium ion concentration was raised from 0.08 mM to 14.7 mM .

For Salmonella NuoA, potential contributions to radical formation include:

  • Influencing the stability of semiquinone intermediates during electron transfer

  • Affecting the accessibility of oxygen to reduced quinones

  • Modulating the kinetics of electron transfer to prevent excessive radical formation

  • Participating in conformational changes that optimize quinone binding and reduction

These processes can have significant implications for oxidative stress management in Salmonella during host infection.

What are the most effective strategies for creating and validating nuoA knockout or mutant strains?

Effective strategies include:

  • Allelic exchange using suicide vectors with positive/negative selection markers

  • CRISPR-Cas9-based genome editing for precise modifications

  • Lambda Red recombineering for scarless mutagenesis

  • Transposon mutagenesis followed by screening for respiratory phenotypes

  • Complementation analysis with plasmid-expressed wild-type or mutant nuoA

Validation should include:

  • PCR verification of the mutation

  • RT-qPCR to assess effects on expression of other nuo genes

  • Western blotting to confirm protein levels

  • Phenotypic characterization (growth rates, respiratory activities)

  • Whole-genome sequencing to identify potential suppressor mutations

The importance of checking for suppressor mutations is highlighted by the finding that Salmonella ubiquinone-biosynthesis mutants readily develop compensatory mutations in nuo genes, which can confound the interpretation of phenotypes .

How can researchers distinguish between direct effects of nuoA mutation and compensatory responses?

To differentiate primary from secondary effects:

  • Use inducible expression systems for time-course studies following NuoA depletion

  • Perform transcriptomic and proteomic analyses at early time points after NuoA inactivation

  • Analyze quinone pool composition by HPLC to identify changes in electron carriers

  • Measure membrane potential and proton motive force to assess bioenergetic adaptations

  • Combine nuoA mutations with deletions in known compensatory pathways

Studies of ubiquinone biosynthesis mutants in Salmonella showed changes in the quinone pool composition, with ubiquinone-deficient strains producing alternative quinones like demethylmenaquinone and menaquinone . Similar adaptations might occur in response to nuoA mutations affecting electron transfer efficiency.

How does nuoA function contribute to Salmonella virulence and pathogenesis?

NADH:quinone oxidoreductase plays a central role in Salmonella's energy metabolism, which is critical during infection. Potential contributions of NuoA to virulence include:

  • Supporting energy generation in oxygen-limited environments within host tissues

  • Contributing to redox balance during oxidative stress

  • Enabling adaptation to different carbon sources available in host niches

  • Potentially participating in reactive oxygen species generation as virulence factors

In Vibrio cholerae, the Na+-translocating NADH:quinone oxidoreductase influences pathogenicity through sodium ion extrusion . While the mechanism is different in Salmonella, the bioenergetic role of NuoA is likely similarly important for pathogenesis.

What is the potential of recombinant nuoA as a component in Salmonella vaccines?

Based on studies of other Salmonella proteins, several factors should be considered:

  • Immunogenicity - NuoA, as a membrane protein, may have limited exposed epitopes

  • Conservation across strains - high conservation would provide broad protection

  • Essentiality - targeting essential metabolic functions may reduce escape mutants

  • Production feasibility - membrane proteins present challenges for recombinant expression

Recent studies of recombinant Salmonella proteins as vaccine candidates have shown that surface-exposed proteins like FliD and FlgK elicit strong immune responses (IgG, IgM, and IgA) in vaccinated chickens, while other proteins (FimA and FimW) showed poor immunogenicity . As NuoA is membrane-embedded rather than surface-exposed, it might be less suitable as a standalone antigen but could be valuable as part of a multi-target subunit vaccine focusing on metabolic vulnerabilities.

How can researchers design experiments to determine if NADH-quinone oxidoreductase inhibitors targeting nuoA would be effective antimicrobials?

A systematic approach would include:

  • Development of a high-throughput screening assay for inhibitors of Salmonella NADH:quinone oxidoreductase activity

  • Structural analysis to identify druggable pockets in or near NuoA

  • Screening of compound libraries against purified enzyme or membrane preparations

  • Structure-activity relationship studies to optimize lead compounds

  • Evaluation of selectivity against bacterial versus mammalian Complex I

  • Assessment of antimicrobial activity in cellular and animal infection models

The screening should include measurements of:

  • NADH oxidation rates

  • Quinone reduction rates

  • Proton translocation efficiency

  • Bacterial growth inhibition

  • Cytotoxicity toward mammalian cells

What spectroscopic methods are most informative for studying nuoA interactions with quinones?

Several complementary spectroscopic approaches provide valuable insights:

  • Electron Paramagnetic Resonance (EPR) spectroscopy - detects semiquinone radicals during enzyme turnover, as demonstrated in Vibrio cholerae membranes where organic radicals centered at g = 2.00 were detected after NADH addition

  • Fluorescence spectroscopy - monitors quinone binding through intrinsic tryptophan fluorescence quenching

  • FTIR difference spectroscopy - identifies vibrational changes associated with quinone binding and reduction

  • Resonance Raman spectroscopy - provides information on quinone redox state changes

  • NMR spectroscopy - maps binding interactions between isotopically labeled quinones and protein

EPR is particularly valuable as it can directly detect semiquinone intermediates formed during catalysis. Studies in Vibrio cholerae showed that increasing sodium ion concentration from 0.08 mM to 14.7 mM led to a twofold increase in radical concentration from approximately 200 μM to 400 μM .

How can researchers quantitatively assess the impact of nuoA mutations on enzyme kinetics?

Kinetic analysis should include:

  • Steady-state kinetics measuring NADH oxidation rates with various quinone substrates

  • Pre-steady-state kinetics using stopped-flow spectroscopy to identify rate-limiting steps

  • Determination of Km and Vmax values for NADH and different quinones

  • Inhibitor binding studies to probe quinone-binding site alterations

  • Proton translocation measurements to assess coupling efficiency

A comprehensive kinetic model should incorporate:

ParameterWild-typenuoA MutantMeasurement Method
NADH KmX mMY mMSpectrophotometric
NADH kcatX s-1Y s-1Spectrophotometric
UQ KmX μMY μMHPLC-based assay
UQ kcatX s-1Y s-1HPLC-based assay
H+/e- ratioXYpH electrode

Table 2: Template for comparing kinetic parameters between wild-type and nuoA mutant enzymes.

What structural biology approaches would provide the most insight into nuoA function?

Multiple structural approaches can be combined:

  • Cryo-electron microscopy of the intact NADH:quinone oxidoreductase complex

  • X-ray crystallography of the membrane domain containing NuoA

  • NMR studies of isolated NuoA in detergent micelles or nanodiscs

  • Cross-linking mass spectrometry to map subunit interfaces

  • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

While obtaining high-resolution structures of membrane proteins remains challenging, advances in cryo-EM have made it possible to solve structures of bacterial respiratory complexes, providing templates for modeling Salmonella NuoA and designing targeted studies.

How does nuoA expression change under different environmental conditions relevant to Salmonella pathogenesis?

Expression patterns can be analyzed using:

  • RNA-seq to measure transcriptional changes

  • Quantitative proteomics to measure protein levels

  • Reporter gene fusions to monitor expression in real-time

  • ChIP-seq to identify transcriptional regulators

  • Single-cell analysis to assess population heterogeneity

Key conditions to investigate include:

  • Oxygen limitation (microaerobic and anaerobic)

  • Acidic pH (mimicking phagolysosomes)

  • Nutrient limitation (carbon, nitrogen, phosphorus)

  • Presence of host-derived antimicrobial compounds

  • Different growth phases (log, stationary, biofilm)

Understanding these expression patterns helps contextualize NuoA's role during different stages of infection.

How does nuoA function integrate with other respiratory complexes in Salmonella heidelberg?

Integration with other respiratory components involves:

Studies of ubiquinone biosynthesis mutants in Salmonella showed adaptations in the quinone pool, with ubiA deletion mutants producing demethylmenaquinone and menaquinone instead of ubiquinone, while ubiE deletion mutants produced demethylmenaquinone and 2-octaprenyl-6-methoxy-1,4-benzoquinone . These changes in the quinone pool affected electron flow through the respiratory chain and required compensatory mutations in NADH:quinone oxidoreductase for optimal function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.