Recombinant Salmonella heidelberg NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its biological significance in Salmonella heidelberg?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of Complex I in the bacterial respiratory chain. In Salmonella species, including S. heidelberg, this protein plays a crucial role in energy metabolism by participating in the electron transport chain. The protein is encoded by the nuoK gene and functions as part of the NADH dehydrogenase I complex, which is responsible for transferring electrons from NADH to quinones in the bacterial membrane . This process is fundamental to cellular respiration and ATP production in these pathogens.

The biological significance of nuoK extends beyond basic metabolism, as respiratory chain components have been implicated in bacterial pathogenesis and survival within host environments. Salmonella heidelberg is a clinically significant serotype that causes an estimated 1.35 million infections and 26,500 hospitalizations annually in the United States . Understanding the functional role of nuoK may provide insights into S. heidelberg's virulence mechanisms and metabolic adaptations during infection.

How does the amino acid sequence of nuoK differ between Salmonella heidelberg and other Salmonella serotypes?

While the complete amino acid sequence of S. heidelberg nuoK is not explicitly provided in the available data, we can analyze the sequence information available for S. newport nuoK as a comparative reference. The S. newport nuoK protein consists of 100 amino acids with the following sequence:

MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

Sequence analysis would typically reveal high conservation among Salmonella serotypes for this protein, with potential minor variations that might influence protein function or stability. Researchers investigating S. heidelberg should conduct comparative sequence analysis to identify any serotype-specific amino acid substitutions that might correlate with functional differences or antimicrobial resistance patterns. Such variations could be particularly relevant given that S. heidelberg has been associated with multidrug-resistant outbreaks .

What expression systems are most effective for producing recombinant Salmonella heidelberg nuoK protein?

Based on existing recombinant protein production protocols, E. coli expression systems have proven effective for producing Salmonella nuoK proteins. For the S. newport nuoK protein, successful expression has been achieved using E. coli with an N-terminal His-tag fusion . This approach enables efficient purification using affinity chromatography while maintaining protein functionality.

For S. heidelberg nuoK specifically, researchers should consider:

• Expression vector selection: Vectors containing inducible promoters (such as T7) with appropriate fusion tags (His, GST, or MBP) to facilitate purification and potentially enhance solubility

• E. coli strain optimization: BL21(DE3) or derivatives that lack certain proteases may improve protein yield

• Induction conditions: Temperature, inducer concentration, and duration require optimization, with lower temperatures (16-25°C) often favoring proper folding of membrane proteins

• Membrane protein considerations: Given that nuoK is a membrane protein, specialized approaches including detergent solubilization or membrane-mimetic systems may be necessary for maintaining native structure

When designing expression constructs, researchers should note that the full-length nuoK protein spans amino acids 1-100, which should be considered when designing primers and expression vectors .

How can researchers verify the structure and functionality of recombinant nuoK protein after purification?

Following purification of recombinant nuoK protein, researchers should implement multiple complementary approaches to assess both structural integrity and functional activity:

Structural verification methods:

• SDS-PAGE analysis to confirm molecular weight and purity (>90% purity is typically achievable)

• Circular dichroism (CD) spectroscopy to assess secondary structure elements

• Mass spectrometry for molecular weight confirmation and post-translational modification analysis

• Limited proteolysis to evaluate protein folding

Functional assays:

• NADH oxidation activity measurements using spectrophotometric assays

• Reconstitution experiments in liposomes to assess membrane integration

• Electron transfer capacity using artificial electron acceptors

• Binding assays with known interaction partners from the NADH dehydrogenase complex

Researchers should store the purified protein according to established protocols, which typically recommend reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a cryoprotectant, followed by aliquoting and storage at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What role might nuoK play in antimicrobial resistance mechanisms in multidrug-resistant Salmonella heidelberg strains?

Multidrug-resistant (MDR) Salmonella heidelberg presents a significant public health concern, with recent outbreaks showing resistance to multiple antimicrobial classes . The potential role of nuoK in antimicrobial resistance warrants investigation from several perspectives:

• Energy metabolism and efflux pump activity: As a component of the respiratory chain, nuoK contributes to energy production that powers efflux pumps responsible for expelling antibiotics from bacterial cells. Research should examine whether alterations in nuoK expression or activity correlate with enhanced efflux pump function in resistant strains.

• Membrane integrity: nuoK's location in the bacterial membrane may influence membrane permeability and, consequently, antibiotic penetration. Mutations or expression changes in nuoK could potentially alter membrane characteristics that affect antimicrobial entry.

• Metabolic adaptation: Changes in respiratory chain function might allow MDR strains to adapt their metabolism under antibiotic pressure, potentially enabling persistence despite antimicrobial treatment.

The multidrug-resistant Salmonella heidelberg strains identified in recent outbreaks carried resistance determinants to several antimicrobial classes, including those used as first-line treatments for severe salmonellosis (ciprofloxacin, ceftriaxone, or azithromycin) . Studies examining nuoK sequence variations or expression levels in these MDR strains compared to susceptible isolates could provide valuable insights into potential associations with resistance mechanisms.

How does the expression of nuoK change under different environmental conditions relevant to Salmonella heidelberg pathogenesis?

Environmental adaptation is crucial for Salmonella pathogenesis across diverse host environments. Research questions regarding nuoK expression should address:

• Host-associated environmental signals: Expression analysis under conditions mimicking the gastrointestinal tract (low pH, high osmolarity, bile salts) versus systemic infection sites (serum, macrophage phagosome)

• Oxygen availability: As a respiratory chain component, nuoK expression and function likely respond to varying oxygen tensions encountered during infection (aerobic intestinal lumen versus microaerobic tissue environments)

• Nutrient availability: Expression changes in response to carbon source availability, particularly host-derived nutrients

• Temperature fluctuations: Comparative expression at environmental (25°C) versus host body temperatures (37°C or 42°C for avian hosts)

Experimental approaches should include:

• Quantitative RT-PCR to measure transcript levels

• Reporter gene fusions to monitor promoter activity in real-time

• Proteomics to assess protein abundance under different conditions

• In vivo expression analysis during various stages of infection

Understanding these expression patterns may provide insights into the protein's role throughout the infection cycle, particularly given that Salmonella heidelberg has been associated with invasive infections that can spread to the bloodstream and increase disease severity .

What are the interactions between nuoK and other components of the NADH dehydrogenase complex in Salmonella heidelberg?

The NADH dehydrogenase complex (Complex I) is a multi-subunit enzyme composed of numerous proteins that must assemble correctly for proper function. Research into nuoK interactions should address:

• Protein-protein interaction mapping: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking studies can identify direct interaction partners of nuoK within the complex.

• Assembly dynamics: Pulse-chase experiments combined with blue native PAGE can elucidate the temporal sequence of complex assembly and the role of nuoK in this process.

• Structural studies: Cryo-electron microscopy of the intact complex could reveal the precise positioning of nuoK and its contacts with neighboring subunits.

• Functional consequences of disrupted interactions: Site-directed mutagenesis targeting residues at predicted interaction interfaces, followed by functional assays, can determine which interactions are crucial for enzyme activity.

How do mutations in the nuoK gene impact Salmonella heidelberg virulence in various host models?

Understanding the relationship between nuoK function and virulence requires systematic investigation using various experimental approaches:

• Construction of defined nuoK mutants:

  • Complete gene deletion mutants

  • Point mutations affecting specific functional domains

  • Conditional expression systems

• In vitro virulence assays:

  • Invasion and intracellular replication in epithelial cells and macrophages

  • Survival under conditions mimicking host environments (acid stress, oxidative stress)

  • Biofilm formation capacity

• Animal infection models:

  • Colonization and persistence in mouse intestinal models

  • Systemic spread and organ burden in invasive infection models

  • Chicken models to assess colonization relevant to food safety

Previous research with Salmonella has shown that respiratory chain components can impact virulence through various mechanisms, including altered intracellular survival, modified motility, or changes in expression of virulence factors. Given that Salmonella heidelberg has demonstrated invasive characteristics with bloodstream infections and increased disease severity , the role of nuoK in virulence deserves particular attention.

What are the optimal conditions for expressing and purifying recombinant Salmonella heidelberg nuoK protein?

Successfully producing recombinant Salmonella nuoK protein requires careful optimization of expression and purification conditions, considering its nature as a membrane protein:

Expression optimization table:

Purification recommendations:

• Membrane extraction: Use appropriate detergents (DDM, LDAO, or Fos-Choline) to solubilize the membrane fraction containing nuoK

• Affinity chromatography: Ni-NTA or similar for His-tagged proteins

• Buffer optimization: Include glycerol (5-10%) and appropriate detergent at concentrations above CMC

• Quality control: Assess purity by SDS-PAGE (target >90% purity)

• Storage: Store in buffer containing 6% trehalose at pH 8.0 with aliquoting to avoid freeze-thaw cycles

Reconstitution of the lyophilized protein should follow established protocols using deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What techniques are most effective for studying the structure-function relationship of nuoK in Salmonella heidelberg?

Investigating structure-function relationships for the nuoK protein requires an integrated approach combining structural biology techniques with functional assays:

Structural analysis approaches:

• X-ray crystallography: Challenging for membrane proteins but could provide high-resolution structures

• Cryo-electron microscopy: Increasingly successful for membrane protein complexes

• NMR spectroscopy: Suitable for analyzing dynamics and ligand interactions

• Computational modeling: Homology modeling based on related structures

• Cross-linking mass spectrometry: For mapping interaction interfaces

Functional characterization methods:

• Site-directed mutagenesis: Target conserved residues or those predicted to be functionally important

• Electron transport assays: Measure NADH oxidation rates and coupling to quinone reduction

• Proton pumping measurements: Assess proton translocation in reconstituted systems

• Complementation studies: Restore function in nuoK-deficient strains with wild-type or mutant variants

Structure-function analysis workflow:

• Generate structural model based on bioinformatics analysis of the nuoK sequence (100 amino acids)

• Identify conserved residues and predicted functional domains

• Create a panel of point mutations targeting these regions

• Express and purify mutant proteins

• Assess structural integrity using the methods described in section 1.4

• Measure functional parameters and compare to wild-type protein

• Correlate structural alterations with changes in function

This systematic approach will help identify key residues and structural elements responsible for nuoK's role in electron transport and potentially in antimicrobial resistance or virulence.

How can researchers effectively study the potential role of nuoK in Salmonella heidelberg antimicrobial resistance?

Investigating nuoK's potential contribution to antimicrobial resistance requires a multifaceted approach:

Genetic approaches:

• Generate knockout or conditional mutants of nuoK in both susceptible and MDR S. heidelberg strains

• Determine minimum inhibitory concentrations (MICs) of various antimicrobials for wild-type and mutant strains

• Construct complemented strains to confirm phenotypic changes are specifically due to nuoK

• Perform gene expression analysis to identify potential compensatory mechanisms

Biochemical and physiological approaches:

• Measure membrane potential in wild-type and nuoK-mutant strains in the presence and absence of antimicrobials

• Quantify intracellular accumulation of fluorescent antibiotic analogs to assess permeability or efflux

• Measure ATP production to determine energy generation capacity

• Assess respiratory chain activity with various electron donors/acceptors

Clinical isolate analysis:

• Sequence nuoK from clinical isolates with varying resistance profiles

• Correlate sequence variations with antimicrobial susceptibility patterns

• Measure nuoK expression levels in resistant versus susceptible isolates

• Test whether nuoK variants from resistant isolates confer resistance when introduced into susceptible strains

This research is particularly relevant given that multidrug-resistant Salmonella heidelberg strains pose a serious human health threat, with increased risk of bloodstream infections and challenging treatment options .

What are the recommended approaches for developing immunological assays to detect nuoK expression in Salmonella heidelberg samples?

Developing robust immunological detection methods for nuoK requires careful consideration of this protein's characteristics as a membrane-embedded component:

Antibody development strategies:

• Antigen selection:

  • Full-length recombinant protein (challenging due to hydrophobicity)

  • Extracellular or periplasmic loop peptides (more accessible)

  • Synthetic peptides corresponding to immunogenic epitopes

• Antibody production:

  • Polyclonal antibodies: Broader epitope recognition but potential cross-reactivity

  • Monoclonal antibodies: Higher specificity but may be challenging to develop against membrane proteins

  • Recombinant antibody fragments: Alternative approach for difficult targets

Immunoassay development considerations:

• Sample preparation protocols:

  • Membrane fraction isolation

  • Detergent solubilization optimization

  • Fixation methods for intact cells

• Detection methods:

  • Western blotting (denatured protein)

  • Immunofluorescence microscopy (cellular localization)

  • Flow cytometry (quantitative analysis)

  • ELISA (quantification in prepared samples)

• Assay validation criteria:

  • Specificity testing against related Salmonella serotypes

  • Sensitivity determination

  • Reproducibility assessment

  • Cross-reactivity evaluation

Recent research on immune responses against recombinant Salmonella proteins in chickens demonstrates the feasibility of generating specific immune responses against Salmonella antigens . While this work focused on different proteins (FliD, FlgK, FimA, and FimW), the methodological approaches could be adapted for nuoK-specific immunoassays.

How might understanding nuoK function contribute to novel antimicrobial development against multidrug-resistant Salmonella heidelberg?

The emergence of multidrug-resistant Salmonella heidelberg strains resistant to first-line antimicrobials necessitates new therapeutic approaches . Research into nuoK as a potential antimicrobial target should consider:

• Target validation studies:

  • Essentiality assessment under various growth conditions

  • Impact of nuoK inhibition on bacterial fitness and virulence

  • Structural differences from human homologs that could be exploited for selectivity

• Inhibitor development approaches:

  • Structure-based drug design targeting specific functional domains

  • High-throughput screening of chemical libraries against nuoK function

  • Peptide inhibitors designed to disrupt critical protein-protein interactions

• Combination therapy potential:

  • Synergistic effects between respiratory chain inhibitors and conventional antibiotics

  • Sensitization of resistant strains through metabolic disruption

• Delivery strategies:

  • Nanoparticle formulations to improve compound access to intracellular bacteria

  • Prodrug approaches to enhance penetration through bacterial membranes

Recent outbreaks of multidrug-resistant Salmonella heidelberg have demonstrated resistance to multiple antimicrobial classes, highlighting the urgent need for novel therapeutic approaches . Targeting essential metabolic pathways like those involving nuoK represents a promising alternative to conventional antimicrobials that are increasingly compromised by resistance mechanisms.

What is the potential for using recombinant nuoK protein in vaccine development against Salmonella heidelberg infections?

Exploring nuoK as a vaccine antigen candidate requires evaluation of several key aspects:

• Antigenicity and immunogenicity assessment:

  • Epitope mapping to identify immunogenic regions

  • Analysis of conservation across Salmonella serotypes and strains

  • Evaluation in animal models for antibody and cell-mediated responses

• Vaccine formulation considerations:

  • Subunit vaccine incorporating purified recombinant nuoK

  • DNA vaccines encoding the nuoK gene

  • Incorporation into existing attenuated live vaccine platforms

  • Adjuvant selection to enhance immunogenicity

• Protection assessment metrics:

  • Reduction in colonization in animal models

  • Prevention of systemic spread

  • Antibody titers and correlation with protection

  • Cross-protection against heterologous strains

• Practical implementation considerations:

  • Stability under various storage conditions

  • Administration routes (oral, injectable, mucosal)

  • Integration with existing vaccination programs

Recent research has demonstrated the feasibility of using recombinant Salmonella proteins as vaccine candidates, with successful immune responses observed in chickens against surface-exposed proteins like FliD, FlgK, FimA, and FimW . While nuoK is primarily membrane-embedded rather than surface-exposed, portions of the protein might still be accessible to the immune system or could be engineered for enhanced exposure.

How can comparative genomics and proteomics approaches enhance our understanding of nuoK variation across Salmonella heidelberg strains?

Comprehensive analysis of nuoK variation requires integration of genomic and proteomic techniques:

• Genomic analysis workflow:

  • Whole genome sequencing of diverse S. heidelberg isolates

  • Identification of nuoK sequence variants

  • Analysis of upstream regulatory regions

  • Assessment of gene neighborhood conservation

  • Detection of horizontal gene transfer events

• Proteomic investigation approaches:

  • Quantitative proteomics to assess nuoK expression levels across strains

  • Post-translational modification profiling

  • Protein-protein interaction network mapping

  • Structural proteomics to detect conformational variations

• Integrated analysis strategies:

  • Correlation of genomic variants with proteomic differences

  • Association of variations with phenotypic characteristics (virulence, AMR)

  • Evolutionary analysis to identify selection pressures

  • Functional impact prediction of observed variations

• Data integration with existing resources:

  • Comparison with WGS data from outbreak investigations

  • Integration with antimicrobial resistance databases

  • Contextualizing findings within metabolic network models

This approach is particularly relevant given the genomic diversity observed in Salmonella heidelberg outbreak strains, which have demonstrated varied resistance profiles and virulence characteristics across different regions and time periods .

What systems biology approaches can reveal about the role of nuoK in Salmonella heidelberg metabolism and pathogenesis?

Systems biology offers powerful tools for understanding nuoK's role within the broader context of Salmonella biology:

• Network analysis approaches:

  • Metabolic flux analysis to quantify the impact of nuoK alterations on cellular metabolism

  • Regulatory network reconstruction to identify factors controlling nuoK expression

  • Protein interaction networks to map functional relationships

  • Pathway enrichment analysis to identify processes affected by nuoK perturbation

• Multi-omics integration strategies:

  • Transcriptomics-proteomics correlation during infection

  • Metabolomics to detect metabolic shifts in nuoK mutants

  • Integration of phenotypic microarray data with gene expression profiles

  • Host-pathogen interaction networks during infection

• Mathematical modeling approaches:

  • Kinetic modeling of electron transport chain function

  • Flux balance analysis to predict metabolic consequences of nuoK perturbation

  • Agent-based modeling of infection dynamics

  • Machine learning to identify patterns in multi-omics datasets

• Experimental validation methods:

  • CRISPR interference for targeted gene expression modulation

  • Metabolic labeling to track flux through specific pathways

  • Single-cell analyses to capture population heterogeneity

  • In vivo imaging to monitor infection dynamics

These approaches could help explain the mechanisms underlying the increased virulence and antimicrobial resistance observed in recent Salmonella heidelberg outbreaks, where isolates demonstrated not only multidrug resistance but also enhanced invasiveness and clinical severity .