Recombinant Salmonella heidelberg p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
aaeA; SeHA_C3663; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the p-hydroxybenzoic acid efflux pump subunit AaeA in Salmonella heidelberg?

The p-hydroxybenzoic acid efflux pump subunit AaeA in Salmonella heidelberg is a membrane fusion protein (MFP) that functions as part of a multicomponent efflux system responsible for extruding p-hydroxybenzoic acid and potentially other antimicrobial compounds from bacterial cells. This protein plays a critical role in the efflux mechanism, forming part of the complex that spans from the inner membrane to the outer membrane of the bacterial cell. The AaeA protein requires interaction with other components to form a functional efflux system that contributes to antimicrobial resistance in S. heidelberg. Similar to other membrane fusion proteins in Gram-negative bacteria, AaeA likely facilitates the connection between the inner membrane transporter and the outer membrane component, allowing for the efficient extrusion of substrates across both membranes .

How does the AaeA efflux pump subunit differ from other efflux components in Salmonella?

The AaeA efflux pump subunit differs from other efflux components in Salmonella in several key ways:

  • Substrate specificity: While multidrug efflux systems like AcrAB-TolC can export a wide range of antibiotics and other compounds, the AaeA-containing system appears to have more specificity for aromatic compounds like p-hydroxybenzoic acid .

  • Structural characteristics: AaeA belongs to the membrane fusion protein (MFP) family, which differentiates it from inner membrane transporters (like AcrB) or outer membrane channels (like TolC) .

  • Genetic regulation: AaeA expression is positively regulated by AaeR, making its regulation distinct from other efflux systems that may be controlled by different regulatory proteins such as those controlling AcrAB expression .

  • Function in resistance: Unlike the AcrAB-TolC system, which plays a dominant role in fluoroquinolone resistance in Salmonella, the AaeA system appears to have a more specialized role in resistance to specific compounds .

Unlike other well-characterized efflux systems such as AcrAB-TolC, which has been demonstrated to have critical roles in both antimicrobial resistance and virulence across multiple Salmonella serovars, the specific contributions of AaeA to S. heidelberg pathogenesis and antimicrobial resistance profiles are still being investigated .

What experimental techniques are used to isolate recombinant AaeA from Salmonella heidelberg?

Isolation of recombinant AaeA from Salmonella heidelberg typically involves a multi-step process combining molecular cloning, heterologous expression, and protein purification techniques:

  • Gene amplification: The aaeA gene is PCR-amplified from Salmonella heidelberg genomic DNA using specific primers designed based on the gene sequence.

  • Cloning: The amplified gene is inserted into an appropriate expression vector containing:

    • A strong promoter (such as T7)

    • Appropriate affinity tags (typically N-terminal or C-terminal His-tag)

    • Selection markers for stable maintenance

  • Expression: The recombinant construct is transformed into a suitable host (commonly E. coli BL21(DE3) or similar strains) for protein expression under optimized conditions .

  • Cell disruption: Bacterial cells are harvested and lysed using methods appropriate for membrane proteins:

    • Mechanical disruption (sonication, French press)

    • Enzymatic lysis (lysozyme treatment)

    • Detergent-based extraction methods

  • Purification: The recombinant protein is purified using:

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Size exclusion chromatography for further purification

    • Ion exchange chromatography if needed

  • Quality control: The purified protein undergoes:

    • SDS-PAGE analysis to confirm purity (≥85% purity is typically achieved)

    • Western blotting for identity confirmation

    • Mass spectrometry for molecular weight verification

Each batch of purified recombinant AaeA should be tested for endotoxin content if intended for functional studies, and protein stability assessments should be performed to determine optimal storage conditions .

How does the AaeA efflux pump contribute to antimicrobial resistance in Salmonella heidelberg?

The AaeA efflux pump subunit contributes to antimicrobial resistance in Salmonella heidelberg through several mechanisms:

  • Direct extrusion of antimicrobial compounds: As part of a multicomponent efflux system, AaeA helps facilitate the export of p-hydroxybenzoic acid and potentially certain antibiotics from the bacterial cell, reducing their intracellular concentration below inhibitory levels .

  • Cooperative function: Similar to how AcrA works with AcrB and TolC, AaeA requires interaction with other components (likely AaeB) to form a complete and functional efflux system. This multiprotein complex spans both membranes of the Gram-negative cell envelope to effectively remove toxic compounds .

  • Specialized resistance: While the AcrAB-TolC system provides broad resistance to multiple antimicrobials in Salmonella, the AaeA-containing system may provide specialized resistance to specific compounds that are not efficiently extruded by other efflux systems .

  • Potential contribution to adaptive resistance: Similar to other efflux systems in Salmonella, the AaeA pump may contribute to adaptive resistance to antimicrobial compounds such as biocides or disinfectants, impacting bacterial survival in poultry production environments .

Research indicates that efflux pump-mediated resistance mechanisms in Salmonella often work in concert with other resistance mechanisms, such as target modifications or enzymatic inactivation of antimicrobials, to produce high-level resistance phenotypes. The specific antimicrobial agents that the AaeA-containing system can extrude in S. heidelberg warrant further investigation, particularly in the context of antimicrobial resistance genes (ARGs) harbored on mobile genetic elements .

What is the relationship between AaeA expression and antimicrobial susceptibility profiles in clinical isolates?

The relationship between AaeA expression and antimicrobial susceptibility profiles in clinical isolates of Salmonella heidelberg shows several important patterns:

A comparative analysis of antimicrobial susceptibility between wild-type strains and isogenic mutants with deleted aaeA would provide definitive evidence for the specific contribution of this efflux component to resistance profiles. Current evidence from studies of S. heidelberg isolates suggests that strains with ARGs on plasmids persist longer in environmental conditions like poultry litter, potentially increasing the risk of transmission and treatment failures .

What molecular mechanisms regulate the expression of the aaeA gene in Salmonella heidelberg?

The expression of the aaeA gene in Salmonella heidelberg is regulated through several molecular mechanisms:

  • Transcriptional regulation by AaeR:

    • The aaeA gene expression is positively regulated by AaeR, a LysR-type transcriptional regulator

    • AaeR binds to specific sequences in the promoter region of the aaeA gene, activating transcription in response to aromatic acid compounds present in the environment

  • Operon structure:

    • The aaeA gene is typically co-transcribed with aaeB and aaeX as part of an operon

    • This coordinated expression ensures all components of the efflux system are produced simultaneously

  • Environmental stress responses:

    • Expression increases under conditions of:

      • Exposure to aromatic acids

      • Specific antimicrobial compounds

      • Environmental stressors that trigger general stress response pathways

  • Global regulation:

    • Multiple global regulators may influence aaeA expression including:

      • Stress-response sigma factors

      • Two-component systems that sense environmental conditions

      • Regulatory networks that control antimicrobial resistance genes

  • Plasmid-associated regulation:

    • When present on plasmids, additional regulatory elements may influence aaeA expression

    • S. heidelberg strains carrying ARGs on plasmids show differential regulation patterns

Understanding these regulatory mechanisms is essential for developing strategies to combat antimicrobial resistance. By targeting the regulatory pathways that control efflux pump expression, researchers may be able to enhance bacterial susceptibility to existing antimicrobials .

What are the optimal expression systems for producing functional recombinant AaeA protein?

The optimal expression systems for producing functional recombinant AaeA protein from Salmonella heidelberg require careful consideration of several factors:

  • Expression host selection:

    • E. coli BL21(DE3): Offers high protein yields and lacks certain proteases

    • E. coli C41(DE3) or C43(DE3): Specialized strains for membrane protein expression

    • Homologous expression in attenuated Salmonella strains: Provides native post-translational modifications

  • Vector system optimization:

    • pET-based vectors: Allow tight control of expression with T7 promoter

    • pBAD vectors: Provide tunable expression with arabinose-inducible promoters

    • Low-copy vectors: May improve folding of membrane proteins like AaeA

  • Fusion tags selection:

    • N-terminal or C-terminal His6-tag: Facilitates purification while minimally affecting function

    • MBP (maltose-binding protein): Enhances solubility

    • SUMO tag: Improves folding and allows tag removal with specific proteases

  • Expression conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction timing: Mid-log phase induction typically yields better results

    • Media composition: Specialized media with osmolytes or chaperone-inducing compounds

  • Membrane extraction methods:

    • Detergent selection: Critical for maintaining native conformation

    • Commonly effective detergents include:

      • n-Dodecyl β-D-maltoside (DDM)

      • n-Octyl β-D-glucopyranoside (OG)

      • Digitonin for gentler extraction

The choice between prokaryotic and eukaryotic expression systems should be guided by the experimental goals. For structural studies requiring large amounts of protein, E. coli-based systems optimize yield. For functional studies, maintaining the native conformation is paramount, potentially favoring homologous expression in Salmonella strains .

How can researchers assess the functional activity of recombinant AaeA in vitro?

Researchers can assess the functional activity of recombinant AaeA in vitro through several complementary approaches:

  • Reconstitution assays:

    • Proteoliposome-based transport assays: Purified AaeA is reconstituted with its partner proteins (like AaeB) into artificial liposomes

    • Substrate accumulation/efflux is measured using:

      • Fluorescent substrates with real-time monitoring

      • Radiolabeled compounds with scintillation counting

      • LC-MS/MS quantification for non-labeled substrates

  • Binding assays:

    • Surface plasmon resonance (SPR): Measures direct binding between AaeA and:

      • Other efflux pump components

      • Potential substrate molecules

      • Inhibitor compounds

    • Isothermal titration calorimetry (ITC): Quantifies thermodynamic parameters of binding interactions

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy: Evaluates secondary structure content

    • Differential scanning calorimetry (DSC): Determines thermal stability

    • Limited proteolysis: Assesses proper folding

  • Complementation studies:

    • AaeA-deficient strains reconstituted with the recombinant protein

    • Restoration of efflux activity measured by:

      • Minimum inhibitory concentration (MIC) determinations

      • Fluorescent dye accumulation assays

      • Growth inhibition zone assays

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with partner proteins

    • Bacterial two-hybrid systems

    • Cross-linking studies followed by mass spectrometry

A standardized in vitro assay for p-hydroxybenzoic acid efflux should include both negative controls (AaeA-deficient systems) and positive controls (native efflux systems) to validate results. Researchers should also consider how the presence of affinity tags might affect protein function and include tag-cleaved versions in their experimental design .

What methodological approaches are most effective for studying AaeA interactions with other efflux pump components?

The most effective methodological approaches for studying AaeA interactions with other efflux pump components combine biochemical, biophysical, genetic, and computational techniques:

  • In vitro protein-protein interaction assays:

    • Pull-down assays: Using tagged recombinant AaeA to identify interacting partners

    • Surface plasmon resonance (SPR): Measuring real-time binding kinetics between purified components

    • Microscale thermophoresis (MST): Detecting interactions in solution with minimal sample consumption

    • Förster resonance energy transfer (FRET): Monitoring proximity between fluorescently labeled components

  • Structural biology approaches:

    • X-ray crystallography: Determining high-resolution structures of protein complexes

    • Cryo-electron microscopy: Visualizing larger assemblies in near-native states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping interaction interfaces

    • Nuclear magnetic resonance (NMR): Analyzing dynamic interactions in solution

  • Genetic and in vivo methods:

    • Bacterial two-hybrid systems: Screening for protein interactions in living cells

    • In vivo cross-linking followed by co-immunoprecipitation: Capturing native complexes

    • Suppressor mutation analysis: Identifying compensatory mutations that restore function

    • Fluorescence microscopy with tagged proteins: Visualizing co-localization in bacterial cells

  • Systems biology approaches:

    • Transcriptomics: Identifying genes co-regulated with aaeA

    • Proteomics: Quantifying changes in protein expression profiles

    • Interactome mapping: Constructing comprehensive protein interaction networks

  • Computational methods:

    • Molecular docking: Predicting binding modes between AaeA and partner proteins

    • Molecular dynamics simulations: Analyzing stability and dynamics of protein complexes

    • Sequence co-evolution analysis: Identifying potentially interacting residues

When studying membrane protein complexes like efflux pumps, maintaining the native membrane environment is critical. Therefore, approaches that preserve the lipid environment (such as native nanodiscs or styrene-maleic acid copolymer extraction) often yield more physiologically relevant results than traditional detergent-based methods .

How does the structure-function relationship of AaeA compare between Salmonella heidelberg and other bacterial species?

The structure-function relationship of AaeA in Salmonella heidelberg compared to other bacterial species reveals both conserved features and species-specific adaptations:

  • Conserved structural domains:

    • Membrane-proximal domain: Anchors the protein to the inner membrane

    • α-hairpin domain: Forms coiled-coil structures that extend into the periplasmic space

    • Lipoyl domain: Mediates interactions with outer membrane components

    • These core domains show high structural conservation across Gram-negative bacteria

  • Species-specific variations:

    • Sequence homology: AaeA from S. heidelberg shares approximately 85-90% sequence identity with E. coli AaeA but lower identity with other species

    • Substrate binding pocket: Subtle amino acid substitutions may alter substrate specificity profiles

    • Surface-exposed loops: Show greater sequence divergence, potentially affecting interactions with species-specific partners

  • Functional conservation and divergence:

    • Core mechanism: The basic function as a membrane fusion protein is preserved across species

    • Regulatory integration: AaeA regulation may be integrated into different species-specific regulatory networks

    • Environmental adaptation: Sequence variations likely reflect adaptation to different ecological niches and exposure to different antimicrobials

  • Comparative analysis with other membrane fusion proteins:

    • AaeA vs. AcrA (in AcrAB-TolC system): Despite functional similarity, they show distinct structural features affecting substrate range

    • AaeA vs. MdtA (in MdtABC system): Both function in efflux systems but with different partner selectivity

    • These differences highlight evolutionary divergence in efflux pump architecture

The structural adaptations in AaeA across different species likely contribute to the varying antimicrobial resistance profiles observed in different bacterial pathogens. Understanding these structure-function relationships provides valuable insights for developing species-specific efflux pump inhibitors as potential therapeutic adjuvants .

What role does AaeA play in Salmonella heidelberg virulence and persistence in host environments?

The role of AaeA in Salmonella heidelberg virulence and persistence in host environments involves multiple interconnected mechanisms:

  • Host colonization and persistence:

    • Environmental adaptation: AaeA-containing efflux systems may contribute to bacterial survival in:

      • Low pH environments (stomach, phagosome)

      • Bile salt-rich conditions (intestine)

      • Antimicrobial peptide exposure in host tissues

    • Similar to the TolC-dependent systems that are required for colonization in the avian gut, AaeA may play a role in S. heidelberg persistence in poultry

  • Stress response integration:

    • Oxidative stress: Efflux systems help manage oxidative damage caused by host immune responses

    • Metabolic adaptation: AaeA may facilitate export of toxic metabolic by-products during host colonization

    • This stress response role parallels findings that efflux pump disruption affects expression of pathogenesis genes

  • Evasion of host defense mechanisms:

    • Antimicrobial peptide resistance: Efflux pumps export host-derived antimicrobial peptides

    • Immune modulator export: Some efflux systems export molecules that interfere with host immunity

    • These mechanisms could contribute to S. heidelberg survival during infection

  • Interaction with the host microbiome:

    • Competition advantage: AaeA-mediated export of inhibitory compounds may provide competitive advantages

    • Biofilm formation: Efflux systems are often important for biofilm development and maintenance

    • Mobile genetic element acquisition: As seen with plasmid and bacteriophage transfer in S. heidelberg strains

  • Environmental persistence:

    • S. heidelberg strains with plasmid-borne ARGs show enhanced persistence in poultry litter

    • Those carrying AmpC-like beta-lactamase genes persisted longer even without antibiotic selection

    • This persistence increases transmission potential between hosts

Experimental evidence from related Salmonella serovars demonstrates that efflux pump components contribute to virulence and host colonization. For example, TolC is required for S. Typhimurium colonization in chicks, although the specific contribution of AcrAB varies between studies. The potential role of AaeA in S. heidelberg virulence merits investigation through similar colonization models .

How do mobile genetic elements influence the distribution and evolution of aaeA in Salmonella heidelberg populations?

Mobile genetic elements significantly influence the distribution and evolution of aaeA in Salmonella heidelberg populations through multiple mechanisms:

  • Horizontal gene transfer dynamics:

    • Plasmid-mediated transfer: Plasmids carrying aaeA or its regulatory elements can spread between bacterial populations

    • Transposon-facilitated mobilization: Insertion sequences may mobilize aaeA between genomic locations

    • Bacteriophage-mediated transduction: As observed in S. heidelberg strains where some clones acquired lysogenic bacteriophage from other populations

  • Co-selection with antimicrobial resistance genes:

    • Physical linkage: When aaeA is located near other ARGs on mobile elements, selection for one resistance determinant maintains the entire element

    • Functional complementarity: Efflux systems often work synergistically with other resistance mechanisms

    • This is exemplified in S. heidelberg strains where:

      • SH-AAFC harbored bla CMY-2 on an IncI1 plasmid

      • SH-FSIS carried multiple ARGs on an IncC plasmid

  • Evolutionary adaptation mechanisms:

    • Increased copy number: S. heidelberg clones persisting in litter carried higher copy numbers of Col plasmids than ancestral strains

    • Acquisition of novel genetic material: Some S. heidelberg strains acquired bacteriophage from other populations

    • These genetic adaptations likely provide selective advantages in specific environments

  • Population-level impacts:

    • Clonal expansion: Successful strains with advantageous mobile genetic elements show clonal expansion

    • Strain displacement: Strains with enhanced fitness due to mobile element acquisition may outcompete others

    • Differential persistence: S. heidelberg strains with plasmid-borne ARGs demonstrated enhanced environmental persistence

The data from broiler litter studies demonstrates that S. heidelberg strains harboring transmissible plasmids carrying AmpC-like beta-lactamase genes persisted longer even without antibiotic selection pressure. This suggests that plasmid acquisition provides fitness advantages beyond simple antimicrobial resistance, potentially involving regulatory effects on efflux systems like those containing AaeA .

How does the substrate specificity of AaeA-containing efflux systems compare to other efflux pumps in Salmonella?

The substrate specificity of AaeA-containing efflux systems compared to other efflux pumps in Salmonella reveals important functional distinctions:

  • Substrate profile comparison:

Efflux SystemPrimary SubstratesAntimicrobial ClassesBiocides/DyesRole in Resistance
AaeA-containingp-hydroxybenzoic acid, aromatic acidsLimited antibiotic spectrumSome phenolic compoundsSpecialized resistance
AcrAB-TolCDiverse hydrophobic/amphipathic compoundsFluoroquinolones, β-lactams, macrolides, tetracyclinesTriclosan, acriflavine, crystal violetDominant MDR mechanism
MdtABCBile salts, novobiocinLimited antibiotic spectrumSome metal ionsSpecialized resistance
EmrABHydrophobic compoundsNalidixic acid, thiolactomycinCCCP, organomercurialsSupplementary resistance
MdfADiverse hydrophobic compoundsChloramphenicol, fluoroquinolonesQuaternary ammonium compoundsSupplementary resistance
  • Structural basis for specificity:

    • AaeA-containing systems: Likely have substrate binding pockets optimized for aromatic acids

    • AcrAB-TolC: Contains a large, flexible binding pocket accommodating diverse substrates

    • These structural differences explain the narrower substrate range of AaeA systems compared to AcrAB-TolC

  • Complementary resistance coverage:

    • When AcrAB is absent or inhibited, other efflux systems including AaeA-containing pumps may provide compensatory resistance

    • In fluoroquinolone-resistant S. Typhimurium strains without AcrB, AcrEF becomes overexpressed through IS element insertions

    • Similar compensatory mechanisms may involve AaeA-containing systems under specific selection conditions

  • Synergistic substrate interactions:

    • Some substrates may be common between different efflux systems but transported with different efficiencies

    • Overlapping substrate specificities create redundancy in resistance mechanisms

    • This redundancy poses challenges for developing broad-spectrum efflux pump inhibitors

The specialized nature of AaeA-containing efflux systems compared to the broader substrate profile of AcrAB-TolC suggests they may have evolved to address specific niche challenges rather than providing broad multidrug resistance. This specialized role may be particularly important in environments containing aromatic compounds or specific antimicrobials not efficiently extruded by other efflux systems .

What emerging technologies can enhance our understanding of AaeA function in Salmonella heidelberg?

Several emerging technologies hold promise for enhancing our understanding of AaeA function in Salmonella heidelberg:

  • Advanced structural biology approaches:

    • Cryo-electron tomography: Visualizing efflux pumps in their native membrane environment

    • Micro-electron diffraction (MicroED): Determining structures from microcrystals of membrane proteins

    • Single-particle cryo-EM: Resolving structures of complete efflux assemblies at near-atomic resolution

    • These methods could reveal the detailed structure of AaeA in complex with its partner proteins

  • High-throughput functional genomics:

    • CRISPR-Cas9 screening: Systematic functional analysis of genes affecting AaeA activity

    • Transposon sequencing (Tn-Seq): Identifying genes essential for AaeA function under selective conditions

    • Dual RNA-Seq: Simultaneously analyzing host and pathogen transcriptomes during infection

  • Advanced imaging technologies:

    • Super-resolution microscopy: Visualizing the spatial organization of AaeA in living cells

    • Single-molecule tracking: Following the dynamics of individual AaeA molecules in real-time

    • Correlative light and electron microscopy (CLEM): Connecting molecular localization with ultrastructural context

  • Innovative biochemical approaches:

    • Native mass spectrometry: Analyzing intact membrane protein complexes

    • Nanodiscs and lipid cubic phase crystallization: Studying membrane proteins in near-native lipid environments

    • Label-free binding assays: Detecting small molecule interactions without fluorescent tags

  • Computational and systems biology tools:

    • Molecular dynamics simulations: Modeling AaeA dynamics at atomistic resolution

    • Machine learning for substrate prediction: Identifying potential new substrates based on molecular features

    • Protein structure prediction using AlphaFold2: Generating accurate models of AaeA and its complexes

  • Microfluidics and organ-on-chip technologies:

    • Bacterial infection models in microfluidic devices: Studying AaeA function during host-pathogen interactions

    • Gradient generators: Analyzing AaeA response to changing antibiotic concentrations

    • Single-cell analysis: Examining heterogeneity in AaeA expression and function

The integration of these technologies could provide unprecedented insights into how AaeA contributes to antimicrobial resistance, environmental persistence, and virulence in Salmonella heidelberg, potentially leading to new strategies for controlling this pathogen .

What strategies can be developed to specifically target AaeA-containing efflux systems to combat antimicrobial resistance?

Developing strategies to specifically target AaeA-containing efflux systems to combat antimicrobial resistance requires a multifaceted approach:

  • Structure-based inhibitor design:

    • Rational drug design targeting:

      • AaeA-specific binding interfaces with partner proteins

      • Unique structural features not present in human proteins

      • Allosteric sites that disrupt efflux pump assembly

    • Fragment-based screening to identify initial chemical scaffolds

    • Computational optimization to enhance specificity and potency

  • Disruption of pump assembly:

    • Peptide inhibitors mimicking critical interaction domains

    • Small molecules that prevent proper assembly of the tripartite complex

    • Compounds that destabilize the assembled pump structure

    • These approaches could be more specific than traditional competitive inhibitors

  • Genetic and regulatory interventions:

    • Antisense RNA strategies targeting aaeA mRNA

    • CRISPR-Cas9 based antimicrobials targeting the aaeA gene

    • Inhibitors of AaeR or other specific regulators of aaeA expression

    • These approaches could prevent pump expression before assembly occurs

  • Combination therapy approaches:

StrategyMechanismPotential AdvantagesDevelopment Considerations
Efflux inhibitor + antibioticBlocks efflux to increase intracellular antibiotic concentrationRestores efficacy of existing antibioticsRequires careful toxicity assessment
Dual-target inhibitorsSingle molecule targets both AaeA and antibiotic targetReduces likelihood of resistance developmentComplex medicinal chemistry challenges
Sequential therapyInitial efflux inhibition followed by antibiotic treatmentPotential for enhanced efficacyRequires precise timing and dosing
Anti-virulence + efflux inhibitionCombines pathogenicity reduction with enhanced antibiotic efficacyMultifaceted approach to infection controlNeed to establish clinical endpoints
  • Exploitation of fitness costs:

    • Identifying conditions where AaeA expression imposes metabolic burdens

    • Developing strategies to amplify these fitness costs

    • Creating selective pressures that disfavor AaeA-expressing strains

  • Environmental management strategies:

    • Developing treatments for poultry litter to reduce persistence of resistant strains

    • Implementing measures to limit the spread of mobile genetic elements

    • These approaches address resistance at the ecological level rather than the cellular level

The development of successful AaeA-targeting strategies requires consideration of potential resistance mechanisms and cross-talk between different efflux systems. Salmonella harboring plasmid-borne resistance determinants have demonstrated enhanced persistence, suggesting that effective control strategies must address both chromosomal and plasmid-encoded components of resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.