Recombinant Salmonella heidelberg Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

The enzyme is encoded by the mdoB gene (synonym: opgB) and belongs to the EC 2.7.8.20 enzyme class. In Salmonella heidelberg, the gene locus is designated SeHA_C4949 . Key features include:

PropertyDetails
Gene NamemdoB (opgB)
Enzyme ClassTransferase (EC 2.7.8.20)
Catalytic ActivityTransfers phosphoglycerol from phosphatidylglycerol to MDOs or arbutin
Host SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Purity≥85% (SDS-PAGE)

Enzymatic Function and Mechanism

Phosphoglycerol transferase I is integral to bacterial membrane physiology:

  • Substrates: Utilizes phosphatidylglycerol as a donor and membrane-derived oligosaccharides (MDOs) or arbutin as acceptors .

  • Products: Generates sn-1,2-diglyceride and phosphoglycerol-modified oligosaccharides, which contribute to osmotic stress adaptation .

  • Genetic Knockout: Mutants lacking mdoB fail to synthesize phosphoglycerol-decorated MDOs, leading to growth defects under stress conditions .

Recombinant Production and Applications

Recombinant expression systems enable large-scale production:

Key Production Parameters

ParameterSpecification
HostE. coli, Yeast, Baculovirus, Mammalian Cells
FormLiquid (glycerol-containing)
Storage Stability-20°C (long-term); 4°C (short-term)
ApplicationsEnzyme kinetics studies, bacterial pathogenesis research

Research Significance in Bacterial Pathogenesis

While mdoB itself is not directly linked to virulence, its role in membrane integrity intersects with stress responses critical for Salmonella survival:

  • Stress Adaptation: MDOs modified by phosphoglycerol enhance bacterial resistance to osmotic and acid stress, indirectly supporting survival in host environments .

  • Multidrug Resistance (MDR): Outbreaks of MDR Salmonella heidelberg (e.g., strains with IncC plasmids) highlight the need to study auxiliary genes like mdoB that may co-evolve with resistance mechanisms .

  • Comparative Genomics: Variants of Salmonella heidelberg exhibit differences in pathogenicity, though mdoB conservation across strains suggests a non-redundant role in basic physiology .

Future Directions

Research priorities include:

  • Elucidating structural determinants of phosphoglycerol transferase I activity via crystallography.

  • Investigating mdoB knockout strains in animal models to assess impacts on colonization and transmission.

  • Exploring enzyme inhibitors as potential adjuvants to antibiotics in MDR Salmonella infections .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary based on purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; SeHA_C4949; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIALALVAVFGALGWVLRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQMRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDGKPNQS FSAVSCSQENIAEFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPD IIRLWNFPKEIKDFTVDRDKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWIDRCYKMAQLWAPALALSTDWCVSQGQLGGQQTVQHVDKAQWQGKTAFKD TMIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTITLHFNNP TDANTLVIAPPAPVSTNEGNILGHSPRKLGIGMVEIKVVNVES
Uniprot No.

Target Background

Function
This enzyme transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the mdoB gene in Salmonella Heidelberg strains?

The mdoB gene in Salmonella Heidelberg encodes Phosphoglycerol transferase I, which is involved in membrane-derived oligosaccharide biosynthesis. Like many Salmonella proteins, mdoB likely contributes to cell envelope integrity. Salmonella Heidelberg contains 553 amino acids with molecular masses around 59-61 kDa for many of its membrane-associated proteins . Genomic studies of S. Heidelberg have revealed considerable conservation within the serotype, though specific gene content can vary between isolates from different production environments . When studying mdoB, researchers should consider that Salmonella Heidelberg isolates from different sources (chicken vs. turkey farms, for example) may show differences in specific subsystems that could affect expression patterns and protein function .

What expression systems are most effective for recombinant Salmonella Heidelberg protein production?

For recombinant expression of Salmonella proteins, E. coli-based systems remain the gold standard in research settings. Based on experimental approaches with other Salmonella proteins, the BL21(DE3) and HMS174(DE3) E. coli strains have been successfully used for recombinant protein expression . When expressing Salmonella membrane-associated proteins like mdoB, researchers should consider:

  • Vector selection: T7-based expression systems are designed to induce strong expression of recombinant mRNAs

  • Cellular compartment targeting: For periplasmic expression, signal peptides may be required

  • Expression conditions: Induction parameters should be optimized as protein translocation can become a bottleneck during high-level expression

For Salmonella proteins specifically, researchers have successfully cloned, expressed, and purified proteins in E. coli cells as demonstrated with the FlgK protein .

How can sequence analysis help predict the functional properties of Salmonella Heidelberg mdoB?

Sequence analysis tools provide valuable insights into mdoB properties before experimental work begins:

Table 1: Recommended Sequence Analysis Tools for mdoB Characterization

Analysis PurposeRecommended ToolsExpected Output
Antigenicity predictionVaxiJen (v2.0)Antigenicity score (threshold 0.4)
Allergenicity assessmentAllerTOP (v2.0)Allergenicity prediction
Toxicity screeningToxinPredToxicity prediction
Solubility estimationProtein-Sol serverPhysiological properties
Adhesion predictionVaxign2Adhesion potential

These tools can be applied to mdoB sequences using default settings in most cases . For physiochemical characterization, properties such as molecular mass, theoretical pI, instability index, aliphatic index, and hydropathicity (GRAVY) should be determined to guide experimental approaches .

What are the optimal conditions for expressing and purifying functional recombinant Salmonella Heidelberg mdoB?

Expression and purification of recombinant mdoB requires careful optimization:

  • Expression strategy: Based on successful approaches with other Salmonella proteins, the gene should be cloned into an appropriate expression vector with temperature-inducible or IPTG-inducible promoters .

  • Host strain selection: BL21(DE3) strains are recommended for initial trials, with HMS174(DE3) as an alternative if toxicity issues arise .

  • Induction parameters: Gradual induction at lower temperatures (16-25°C) often improves folding of membrane-associated proteins. RNA-seq data suggests that strong T7-based expression can overwhelm the Sec translocation machinery, which may affect proper folding of membrane-associated proteins like mdoB .

  • Buffer optimization: For membrane-associated proteins, inclusion of appropriate detergents is critical. Consider supplementation with Mg²⁺ as its depletion has been shown to affect protein production in Salmonella and E. coli .

  • Purification strategy: Affinity chromatography using His-tags followed by size exclusion chromatography is recommended, with buffers containing stabilizing agents like glycerol.

RNA-seq data from recombinant protein expression studies suggests that monitoring transcription of stress response genes like the pspABCDE operon can help optimize production conditions .

How can epitope mapping techniques be applied to study Salmonella Heidelberg mdoB immunogenicity?

Epitope mapping of mdoB can utilize both computational prediction and experimental validation approaches:

Computational epitope prediction:
Multiple B-cell epitope prediction algorithms should be employed in parallel, as each uses different parameters based on amino acid properties including flexibility, accessibility, hydrophilicity, surface exposure, turns, helices, and polarity . For accurate epitope identification, consensus sequences from multiple prediction tools should be prioritized, similar to the approach used for FlgK protein where four overlapped consensus epitope sequences were identified .

Experimental validation:
For in vivo validation, recombinant protein can be:

  • Expressed and purified from E. coli

  • Emulsified in adjuvants (e.g., Freund's incomplete adjuvant)

  • Administered to animal models (100 μg protein per dose recommended)

  • Boosted after 2-3 weeks

  • Sera collected for antibody analysis

Epitope extraction, where the antigen is proteolytically digested with trypsin followed by antibody binding and detection by mass spectrometry, can confirm computational predictions . This technique has proven reliable when compared with other epitope mapping approaches for Salmonella proteins .

What role might mdoB play in antimicrobial resistance mechanisms of Salmonella Heidelberg?

Researchers investigating potential connections between mdoB and antimicrobial resistance should consider:

How does mdoB expression respond to environmental stresses in Salmonella Heidelberg?

Environmental stresses significantly impact membrane protein expression in Salmonella:

  • RNA-seq approach: Transcriptomic analysis using RNA-seq can reveal how mdoB expression changes under different conditions. Similar approaches with other proteins have identified multifaceted gene expression responses to protein production stress .

  • Key stress responses to monitor:

    • Cell envelope stress response pathways, particularly the Psp response (regulated by PspF transcription factor)

    • Sec translocon capacity limitations, which appear during high-level expression

    • Magnesium limitation responses, as Mg²⁺ depletion affects ATP levels and translation in Salmonella

    • PhoPQ two-component system, which is triggered by decreased oxidizing activity in the periplasm

  • Experimental design considerations: When studying environmental adaptation, researchers should compare isolates from different production environments (e.g., chicken vs. turkey farms), as they show differences in specific subsystems that may affect survival and virulence abilities .

What techniques are most effective for studying interactions between mdoB and other membrane components?

To investigate how mdoB interacts with other membrane components:

  • Crosslinking mass spectrometry: This can identify protein-protein interactions in their native membrane environment. For the epitope extraction method, proteolytic digestion with trypsin followed by antibody binding and mass spectrometry detection has proven effective with Salmonella proteins .

  • Membrane reconstitution systems: Reconstituting mdoB in liposomes of defined composition can help determine its lipid requirements and interactions.

  • Fluorescence microscopy: Fluorescently tagged mdoB can reveal its localization and dynamics within bacterial membranes.

  • Genetic approaches: Construction of conditional depletion strains can reveal synthetic phenotypes when mdoB function is compromised along with other membrane components.

  • Structural biology: X-ray crystallography or cryo-EM of mdoB alone or in complex with interaction partners can provide atomic-level details of interactions.

Researchers should pay particular attention to potential interactions with phospholipids, as phosphatidylglycerol and cardiolipin contribute to translocation of proteins by stabilizing the SecYEG complex and binding to SecA to stimulate its ATPase activity .

How can recombinant mdoB be utilized in vaccine development strategies against Salmonella Heidelberg?

Vaccine development using recombinant Salmonella proteins follows several established approaches:

  • Epitope identification: Both in silico prediction and in vivo experimental validation should be combined to identify immunogenic epitopes. For Salmonella proteins, immunoinformatic tools have successfully identified consensus peptide epitope sequences that could serve as vaccine targets .

  • Delivery strategies: Several options exist for delivering recombinant Salmonella antigens:

    • Subunit vaccines: Purified recombinant protein emulsified in adjuvants

    • mRNA vaccines: Recent COVID-19 mRNA vaccine technology could be adapted for encoding desired Salmonella proteins/epitopes

    • Multi-epitope vaccines: Designed based on immunoinformatic tools

  • Animal testing protocol: Based on successful approaches with other Salmonella proteins:

    • Administer 100 μg of recombinant protein emulsified in adjuvant

    • Deliver subcutaneously at one week of age

    • Provide booster doses at three weeks of age

    • Collect blood samples at five weeks for antibody analysis

  • Evaluation metrics: Effectiveness should be assessed through:

    • Antibody titers

    • Protection against challenge

    • Cross-protection against different strains

    • Duration of immunity

Given that Salmonella Heidelberg is prevalent in poultry production systems across North America and multidrug-resistant isolates are emerging , effective vaccines would have significant impact on both poultry production and public health.

What analytical methods are recommended for detecting structural changes in mdoB under different experimental conditions?

Researchers studying structural changes in mdoB should consider:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) and can monitor changes under different conditions.

  • Differential scanning calorimetry (DSC): Measures thermal stability and can detect conformational changes induced by ligands or environmental factors.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps solvent-accessible regions and can identify conformational changes with high resolution.

  • Limited proteolysis coupled with mass spectrometry: Identifies flexible or exposed regions that become protected or exposed under different conditions.

  • Tryptophan fluorescence spectroscopy: If mdoB contains tryptophan residues, their fluorescence can serve as a probe for local structural changes.

For membrane-associated proteins like mdoB, detergent composition and concentration significantly affect structural studies. Researchers should carefully optimize these parameters, considering that changes in membrane phospholipid composition (particularly phosphatidylglycerol and cardiolipin levels) can affect membrane protein function .

How can researchers address the challenge of membrane localization when studying recombinant Salmonella Heidelberg mdoB?

Working with membrane-associated proteins presents specific challenges:

  • Expression optimization:

    • Monitor activation of stress responses, particularly the Psp response (regulated by PspF transcription factor), which is induced by blockage of protein translocation across the inner membrane

    • Consider supplementation with magnesium, as Mg²⁺ depletion has been shown to affect protein production

  • Detergent selection:

    • Screen multiple detergent classes (maltoside, glucoside, phosphocholine)

    • Test various chain lengths within each class

    • Use stability assays to identify optimal conditions

  • Membrane mimetic environments:

    • Consider nanodiscs, bicelles, or amphipols as alternatives to detergent micelles

    • Reconstitute into liposomes of defined composition for functional studies

  • Co-expression strategies:

    • Co-express with known interaction partners

    • Include chaperones to assist proper folding

    • Consider fusion proteins to enhance stability

  • In situ analysis:

    • Study the protein in its native environment using techniques like cryo-electron tomography

    • Use in-cell NMR or EPR to study structural dynamics

When studying recombinant membrane proteins, researchers should monitor transcript levels of genes involved in membrane stress responses, as these can provide insights into potential expression bottlenecks .

What strategies can overcome the challenges of distinguishing strain-specific variations in mdoB function across Salmonella Heidelberg isolates?

Researchers studying strain variation in mdoB should implement:

  • Comprehensive sampling strategy:

    • Include isolates from diverse sources (chicken farms, turkey farms, environmental samples)

    • Consider temporal differences in isolate collection

    • Include isolates with different antimicrobial resistance profiles

  • Genomic characterization:

    • Perform whole genome sequencing of all isolates

    • Compare using RAST and SEED to identify differences in specific subsystems

    • Analyze mdoB sequence conservation and surrounding genetic elements

  • Functional validation:

    • Express and purify mdoB from multiple strains

    • Compare biochemical properties and activity

    • Perform complementation studies with mdoB variants in knockout backgrounds

  • Data integration approach:

    • Correlate genomic data with functional properties

    • Consider strain relatedness determined by methods like PFGE

    • Integrate with phenotypic data (antimicrobial resistance, virulence)

Table 2: Suggested Analysis Framework for Strain Variation Studies

Level of AnalysisMethodsExpected Outcomes
GenomicWhole genome sequencing, RAST/SEED analysisIdentification of sequence variations in mdoB and associated pathways
TranscriptomicRNA-seq under standardized conditionsExpression differences across strains
ProteomicProtein expression/purification, activity assaysFunctional differences between mdoB variants
PhenotypicAntimicrobial susceptibility, virulence assaysCorrelation between mdoB variations and phenotypes

When interpreting strain differences, consider that strains from the same integrated poultry company often show high genetic similarity (sometimes 100%), suggesting common sources of contamination .

How might mdoB function contribute to Salmonella Heidelberg adaptation to different host environments?

Investigating mdoB's role in host adaptation represents an important research direction:

  • Comparative expression analysis:

    • Compare mdoB expression between isolates from different hosts (chicken vs. turkey farms)

    • Examine expression changes during infection of different host cell types

    • Monitor expression in response to host-specific environmental stresses

  • Host-pathogen interaction models:

    • Develop cell culture models representing different host environments

    • Examine mdoB knockout effects on invasion and survival in different cell types

    • Test impacts of specific mdoB polymorphisms on host-specific virulence

  • Membrane adaptation mechanisms:

    • Investigate how mdoB contributes to membrane composition adjustments

    • Examine roles in modifying surface charge through phosphoglycerol transfer

    • Study potential impacts on antimicrobial peptide resistance in different hosts

  • Environmental persistence:

    • Test how mdoB contributes to survival in farm environments

    • Examine potential roles in biofilm formation or desiccation resistance

    • Investigate impacts on transmission between hosts

Researchers should consider that distinct poultry production environments affect Salmonella genomic content, potentially influencing survival and virulence abilities . Comparative genomic studies have identified differences in specific subsystems between chicken- and turkey-associated environmental isolates .

What emerging technologies could enhance our understanding of mdoB structure-function relationships?

Several cutting-edge approaches could advance mdoB research:

  • Cryo-electron microscopy (Cryo-EM):

    • Single-particle analysis for high-resolution structures

    • Tomography for in situ visualization

    • Time-resolved studies for capturing different conformational states

  • Integrative structural biology:

    • Combining multiple techniques (X-ray, NMR, SAXS, mass spectrometry)

    • Computational modeling and simulation

    • Molecular dynamics to study conformational changes

  • Native mass spectrometry:

    • Study protein-lipid interactions

    • Characterize complexes with interaction partners

    • Examine conformational dynamics

  • CRISPR-based approaches:

    • Domain-specific tagging for localization studies

    • High-throughput mutagenesis to identify critical residues

    • CRISPRi for controlled expression modulation

  • Single-molecule techniques:

    • FRET to study conformational changes

    • Force spectroscopy to examine mechanical properties

    • Tracking to study dynamics in living cells

These technologies could help resolve how structural features of mdoB contribute to its enzymatic activity and how site-directed mutagenesis could be used to modify these properties for research or application purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.