Recombinant Salmonella heidelberg Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Key Mechanistic Insights

  • Flippase Activity: ArnE interacts with ArnF as part of a heterodimeric complex to facilitate the flipping of L-Ara4N-phosphoundecaprenol across the inner membrane .

  • Lipid A Modification: The transferred L-Ara4N is subsequently incorporated into lipid A by ArnT, a cytoplasmic enzyme, creating a modified LPS structure critical for evading host immune responses and antimicrobial agents .

  • Plasmid-Mediated Resistance: In Salmonella heidelberg, antimicrobial resistance genes (e.g., blaCMY-2, floR) are often carried on IncI1 plasmids, which may coexist with flippase-related genes .

Table 1: Recombinant ArnE Proteins from Salmonella Serovars

Source SerovarAccession NumberLength (aa)Expression SystemTags/Modifications
Salmonella paratyphi AC0Q0661–111E. coliN-terminal His tag
Salmonella paratyphi CQ7UC611–111E. coliN-terminal His tag

Data compiled from . Note: No Salmonella heidelberg ArnE recombinant proteins are explicitly documented in available sources.

Role in Antimicrobial Resistance and Survival

In Salmonella heidelberg, the flippase complex (including ArnE) contributes to resistance by:

  1. Reducing LPS Charge: L-Ara4N modification of lipid A lowers the negative charge of LPS, reducing binding to cationic antimicrobials like colistin .

  2. Stress Adaptation: Modified LPS may enhance survival in environments with low water activity, as observed in pine wood shavings (PWS) used as broiler litter .

Table 2: Survival and Resistance Patterns in Salmonella heidelberg

Strain TypeKey Resistance GenesPlasmid TypeSurvival in PWS (21 days)
SH-AAFC (AMR)blaCMY-2 (IncI1)IncI1High
SH-FSIS (MDR)floR, cmlA1, tet(A) (IncC)IncCModerate
SH-ARS (Pan-susceptible)NoneNoneLow

Adapted from . AMR = antimicrobial resistance; MDR = multidrug resistance.

Genetic and Functional Interactions

ArnE’s activity is tightly linked to other genes in the arn operon:

  • ArnF: Partner subunit of the flippase complex; recombinant ArnF from Salmonella heidelberg (B4TBH0) has been characterized .

  • ArnT: Cytoplasmic enzyme responsible for transferring L-Ara4N to lipid A .

  • Plasmid Dynamics: IncI1 plasmids in Salmonella heidelberg often carry blaCMY-2 (AmpC β-lactamase), while IncC plasmids harbor MDR genes .

Research Gaps and Future Directions

  1. Heidelberg-Specific ArnE Data: No recombinant ArnE proteins from Salmonella heidelberg are documented; structural studies are needed.

  2. Plasmid-Flippase Interactions: The role of plasmids in stabilizing ArnE expression or enhancing survival warrants further investigation.

  3. Drug Target Potential: The flippase complex could serve as a novel target for antimicrobial therapies, particularly against polymyxin-resistant strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format preference, please specify it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
arnE; SeHA_C2542; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
arnE
Target Protein Sequence
MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ArnE in Salmonella heidelberg antimicrobial resistance?

ArnE functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, which plays a critical role in lipopolysaccharide (LPS) modification pathways. This protein is typically encoded as part of the arnBCADTEF operon, responsible for synthesizing and transferring 4-amino-4-deoxy-L-arabinose (Ara4N) to lipid A in the bacterial outer membrane. The addition of Ara4N reduces the negative charge of the bacterial cell surface, decreasing the binding affinity of cationic antimicrobial peptides and certain antibiotics, particularly polymyxins.

In Salmonella heidelberg, antimicrobial resistance mechanisms frequently involve multiple genetic determinants. Studies have identified strains carrying various resistance genes on plasmids, including blaCMY-2 on IncI1 plasmids and multiple resistance genes on IncC plasmids . While the specific contribution of ArnE to these resistance profiles remains to be fully characterized, its role in membrane modification suggests it may work in concert with plasmid-encoded resistance mechanisms to enhance bacterial survival under antimicrobial pressure.

For effective antimicrobial resistance research, investigators should examine ArnE in the context of the complete Arn pathway, considering how LPS modifications interact with other resistance mechanisms. Methodologically, this requires a combination of genetic knockout studies, complementation experiments, and membrane composition analysis to determine the specific contribution of ArnE to antimicrobial resistance phenotypes in S. heidelberg.

How does Salmonella heidelberg persistence in environmental samples relate to antimicrobial resistance?

Research on S. heidelberg environmental persistence has revealed complex relationships between antimicrobial resistance profiles and survival capabilities. Studies examining S. heidelberg survival in pine wood shavings (PWS) used as broiler litter demonstrate that strains with different resistance profiles exhibit varying persistence patterns. Notably, strains harboring the blaCMY-2 gene on an IncI1 plasmid survived longer in PWS than either multidrug-resistant strains or pan-susceptible strains . This suggests that specific resistance determinants may confer additional fitness advantages beyond direct antimicrobial resistance.

A particularly significant finding was that S. heidelberg clones persisting in litter carried higher copy numbers of Col plasmids compared to their ancestors, suggesting that plasmid dynamics play an important role in adaptation to environmental stresses . This finding highlights how mobile genetic elements, which often carry antimicrobial resistance genes, may provide adaptive advantages beyond direct resistance to antibiotics.

To methodologically investigate these relationships, researchers should design longitudinal survival studies in relevant environmental matrices, incorporate multiple strains with well-characterized resistance profiles, monitor environmental parameters throughout the study period, and perform genomic analysis of isolates recovered at different time points to identify adaptive changes.

What is the significance of plasmids in Salmonella heidelberg antimicrobial resistance?

Plasmids play a central role in S. heidelberg antimicrobial resistance, serving as mobile genetic platforms that both carry resistance determinants and potentially influence bacterial fitness. Research has identified specific plasmid types strongly associated with antimicrobial resistance in S. heidelberg, including IncI1 plasmids carrying blaCMY-2 genes and IncC plasmids harboring multiple resistance determinants such as floR, cmlA1, tet(A), blaTEM-1B, and various aminoglycoside resistance genes .

The significance of these plasmids extends beyond simply carrying resistance genes. Studies have demonstrated that S. heidelberg strains harboring transmissible plasmids with AmpC-like beta-lactamase genes persist longer in environmental samples even without antibiotic selection pressure . This suggests plasmids may confer additional adaptive advantages that enhance bacterial fitness in various environmental conditions.

Research has also identified a relationship between plasmid copy number and bacterial persistence. S. heidelberg clones that survived longer in pine wood shavings carried higher copy numbers of Col plasmids compared to their ancestors, indicating that plasmid amplification may be an adaptive response to environmental stress . This points to complex regulatory mechanisms that bacteria employ to optimize plasmid carriage based on environmental conditions.

Interestingly, comparative studies of S. heidelberg variants involved in a bovine outbreak revealed that an IncI1 plasmid was present in a less pathogenic variant but absent in a more pathogenic variant . This counterintuitive finding suggests that plasmid-host interactions are highly complex, with plasmids potentially influencing virulence, host adaptation, and fitness in ways that depend on the specific genetic context.

How do different Salmonella heidelberg strains vary in their virulence and pathogenicity?

Salmonella heidelberg strains exhibit substantial variation in virulence and pathogenicity, with significant implications for host range and disease severity. A particularly illuminating example comes from a 2015-2017 multidrug-resistant S. heidelberg outbreak associated with dairy beef calves, where two variants with distinct pulse-field gel electrophoresis (PFGE) patterns demonstrated markedly different pathogenicity profiles .

The variant designated SX 245 (PFGE pattern JF6X01.0523) was characterized as highly pathogenic, causing elevated morbidity and mortality in affected calves. In contrast, variant SX 244 (PFGE pattern JF6X01.0590) produced less severe disease outcomes and was classified as a low pathogenicity variant . This observation is particularly noteworthy because S. heidelberg has traditionally been considered a poultry-associated serovar, making this outbreak an example of host range expansion with severe clinical manifestations in a bovine host.

Table 1: Comparison of S. heidelberg Variants from Bovine Outbreak

Strain IDPFGE PatternPathogenicityKey Genetic FeaturesCellular InvasionClinical Outcome
SX 245JF6X01.0523HighLacks ~200 genes present in SX 244; Contains 8 unique genesHigher invasion of human and bovine epithelial cellsHigh morbidity and mortality
SX 244JF6X01.0590LowContains IncI1 plasmid and phages absent in SX 245Lower invasion capabilityReduced morbidity and mortality

These pathogenicity differences correlated with distinct phenotypic characteristics. The more pathogenic SX 245 strain demonstrated enhanced invasion capabilities in both human and bovine epithelial cells compared to SX 244 . This increased cellular invasion likely contributed to the more severe disease manifestations observed in calves infected with SX 245, including septicemia and death.

To methodologically investigate such virulence differences, researchers should implement a comprehensive approach including molecular typing methods, comparative genomics, in vitro cellular assays, transcriptomic analysis, and careful correlation of laboratory findings with epidemiological data from outbreaks.

What genomic factors contribute to increased pathogenicity in certain Salmonella heidelberg strains?

Genomic comparison of S. heidelberg variants with different pathogenicity levels has revealed several key factors that may contribute to enhanced virulence. In the bovine outbreak strains, whole-genome sequencing showed that the highly pathogenic variant SX 245 lacked approximately 200 genes present in the less pathogenic SX 244, including genes associated with the IncI1 plasmid and phages . Conversely, SX 245 contained eight genes absent in SX 244, including a second YdiV Anti-FlhC(2)FlhD(4) factor, a lysin motif domain-containing protein, and a pentapeptide repeat protein .

RNA-sequencing analysis provided additional insights, demonstrating that genes related to fimbriae, flagella, and chemotaxis had significantly increased expression in the more pathogenic SX 245 strain compared to SX 244 . This transcriptomic evidence suggests that upregulation of genes involved in type 1 fimbriae production, flagellar regulation and biogenesis, and chemotaxis may play critical roles in the increased pathogenicity and host range expansion observed in S. heidelberg .

The relationship between mobile genetic elements and pathogenicity appears complex and context-dependent. While the absence of an IncI1 plasmid in SX 245 correlates with increased pathogenicity in the bovine outbreak scenario , other research has shown that plasmids can enhance bacterial fitness in different contexts. For example, S. heidelberg strains with higher copy numbers of Col plasmids demonstrated enhanced environmental persistence , highlighting the context-specific nature of genetic factors in bacterial adaptation.

To methodologically investigate genomic factors contributing to pathogenicity, researchers should employ whole genome sequencing and comparative genomics, conduct RNA-sequencing under relevant conditions, perform gene knockout and complementation studies, and use bioinformatic approaches to identify virulence-associated genetic elements and their regulatory networks.

What experimental approaches are effective for studying antimicrobial resistance in Salmonella heidelberg?

Studying antimicrobial resistance in S. heidelberg requires a multifaceted approach combining microbiological, molecular, and genomic techniques. Based on successful research strategies, the following methodological framework provides a comprehensive approach to investigating resistance mechanisms:

  • Strain isolation and characterization:

    • Isolate S. heidelberg from relevant sources (clinical, food, environmental)

    • Perform serotyping and molecular confirmation

    • Conduct pulse-field gel electrophoresis (PFGE) or whole genome sequencing for strain typing

    • Document source information and clinical data for each isolate

  • Antimicrobial susceptibility testing:

    • Implement standardized methods (disk diffusion, broth microdilution)

    • Test against a comprehensive panel of clinically relevant antibiotics

    • Determine minimum inhibitory concentrations (MICs)

    • Interpret results according to established clinical breakpoints

  • Genetic characterization of resistance:

    • Perform whole genome sequencing

    • Identify antimicrobial resistance genes using bioinformatic tools

    • Characterize plasmids and mobile genetic elements

    • Determine the genomic location of resistance determinants

  • Functional validation studies:

    • Generate knockout mutants of specific resistance genes

    • Conduct complementation studies to confirm gene function

    • Perform conjugation experiments to assess horizontal gene transfer

    • Test stability of resistance under various environmental conditions

  • Environmental persistence assessment:

    • Inoculate strains into relevant environmental matrices (e.g., pine wood shavings)

    • Monitor survival over time using culture-based methods

    • Track environmental parameters such as water activity

    • Compare persistence between strains with different resistance profiles

Table 2: Comparison of S. heidelberg Strains with Different Antimicrobial Resistance Profiles

Strain IDSourceResistance ProfileKey Resistance GenesPlasmid TypeRelative Persistence
SH-AAFCBroiler chicken fecesResistantblaCMY-2IncI1Higher
SH-FSISBroiler chicken thighMultidrug-resistantfloR, cmlA1, tet(A), blaTEM-1B, othersIncCLower
SH-ARSBroiler chicken carcassPan-susceptibleNone identifiedNone reportedLower

This methodological framework has been successfully applied in research studying S. heidelberg persistence in pine wood shavings, where researchers inoculated strains with different antimicrobial resistance profiles, monitored survival over 21 days, performed antibiotic susceptibility tests, and conducted whole genome sequencing on isolates .

How can researchers design experiments to study recombinant bacterial proteins like ArnE?

Designing robust experiments to study recombinant bacterial proteins such as ArnE requires careful planning across multiple stages, from gene cloning to functional characterization. The following methodological framework provides a comprehensive approach for investigating membrane-associated proteins like the ArnE flippase subunit:

  • Gene cloning and expression vector construction:

    • Obtain the genomic sequence of the arnE gene from reference S. heidelberg genomes

    • Design primers with appropriate restriction sites for directional cloning

    • Amplify the gene and clone into an expression vector with a suitable affinity tag

    • Verify the construct by sequencing to ensure sequence integrity

  • Expression system optimization:

    • Select an appropriate expression system, considering the membrane-associated nature of ArnE

    • For membrane proteins, consider specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

    • Systematically test expression conditions (temperature, induction time, inducer concentration)

    • Evaluate protein localization in membrane versus soluble fractions

  • Protein purification strategy:

    • Develop an optimized membrane protein extraction protocol

    • Select appropriate detergents for solubilization based on protein characteristics

    • Implement affinity chromatography based on the chosen tag system

    • Conduct size exclusion chromatography for further purification and oligomeric state determination

    • Confirm purity by SDS-PAGE and identity by Western blotting or mass spectrometry

  • Functional characterization approaches:

    • Develop in vitro assays to measure flippase activity

    • Consider using fluorescently labeled lipid substrates to track translocation events

    • Reconstitute the protein in liposomes to study function in a membrane environment

    • Perform kinetic analyses to determine enzymatic parameters

When working specifically with the ArnE protein from S. heidelberg, researchers should consider its potential interactions with other components of the Arn pathway and its role in lipopolysaccharide modification. Experimental designs should include controls to verify protein functionality, such as complementation of ΔarnE mutants or in vitro assays demonstrating lipid flipping activity.

For comprehensive characterization, researchers should also consider structural studies to understand the protein's membrane topology and potential interaction interfaces. This multifaceted approach allows for thorough investigation of the protein's biochemical properties, structural features, and functional significance in antimicrobial resistance mechanisms.

What considerations are important in designing studies of bacterial persistence in environmental samples?

Designing robust studies of bacterial persistence in environmental samples requires careful attention to multiple factors that can influence survival and detection. Based on successful research approaches, the following methodological framework addresses key considerations for investigating S. heidelberg persistence in relevant environments:

  • Environmental matrix selection and characterization:

    • Choose environmentally relevant matrices (e.g., pine wood shavings for poultry-associated bacteria)

    • Characterize physical and chemical properties (pH, moisture content, nutrient composition)

    • Measure water activity, which has been strongly correlated with bacterial survival

    • Consider sterilizing the matrix if necessary to eliminate background microflora

  • Bacterial strain selection strategy:

    • Include multiple strains with different characteristics (e.g., antimicrobial resistance profiles)

    • Use well-characterized strains with known genetic backgrounds

    • Consider creating defined strain cocktails for comprehensive assessment

    • Include appropriate control strains for comparison

  • Inoculation and sampling methodology:

    • Develop standardized inoculation procedures to ensure uniform distribution

    • Determine appropriate inoculation levels (typically 10^6-10^8 CFU/g)

    • Establish a time-course sampling plan (e.g., days 0, 1, 7, 14, 21)

    • Include sufficient technical and biological replicates for statistical validity

  • Environmental condition monitoring:

    • Continuously monitor temperature and relative humidity

    • Regularly measure water activity throughout the experimental period

    • Document any changes in the physical state of the environmental matrix

    • Control for external factors that might influence experimental outcomes

The importance of these methodological considerations is highlighted in research on S. heidelberg persistence in pine wood shavings, where careful monitoring of water activity revealed its correlation with bacterial survival rates . Additionally, comparison of strains with different antimicrobial resistance profiles demonstrated that persistence capabilities varied significantly between strains, with those carrying certain plasmids showing enhanced survival .

To maximize the value of persistence studies, researchers should also incorporate genetic analysis of surviving populations to identify adaptations that emerge during the experimental period. This approach successfully identified increased Col plasmid copy numbers in persistent S. heidelberg clones, providing insight into potential mechanisms of enhanced survival .

How should researchers interpret differences in survival rates between antimicrobial resistant strains?

Interpreting differences in survival rates between antimicrobial resistant strains requires a nuanced analytical approach that considers multiple factors beyond the mere presence of resistance genes. Based on research findings and established analytical methods, the following framework addresses key considerations for meaningful interpretation:

  • Distinguishing correlation from causation:

    • When observing that a strain with a specific resistance profile (e.g., harboring blaCMY-2 on an IncI1 plasmid) survives longer than others , researchers should implement controlled experiments to test causality

    • Consider plasmid curing experiments to determine if resistance determinants directly influence survival

    • Perform plasmid transfer experiments to assess whether resistance elements confer survival advantages in new genetic backgrounds

    • Evaluate whether the observed correlation remains consistent across different environmental conditions

  • Analyzing genetic context effects:

    • Examine the complete genetic context of resistance determinants, not just the resistance genes themselves

    • Consider whether chromosomal factors interact with resistance determinants to influence survival

    • Assess whether the positioning of resistance genes (chromosome vs. plasmid) affects their impact on survival

    • Investigate potential epistatic interactions between resistance mechanisms and core genome functions

  • Evaluating plasmid-mediated effects beyond resistance:

    • When resistance is plasmid-mediated, analyze plasmid characteristics beyond resistance genes

    • Measure plasmid copy number changes in surviving populations, as higher copy numbers of certain plasmids have been associated with enhanced survival

    • Sequence complete plasmids to identify non-resistance genes that might contribute to fitness

    • Assess plasmid stability throughout the experimental period

  • Integrating environmental factor analysis:

    • Calculate correlation coefficients between environmental parameters (e.g., water activity) and strain survival

    • Determine whether different resistant strains respond differently to environmental stresses

    • Consider whether resistance mechanisms affect cellular physiology in ways that enhance stress tolerance

    • Examine interaction effects between multiple environmental factors

In studies of S. heidelberg in pine wood shavings, researchers observed that strains harboring the blaCMY-2 gene on an IncI1 plasmid survived longer than other strains, including a multidrug-resistant strain with multiple resistance genes on an IncC plasmid . This counterintuitive finding suggests that survival advantages are not simply proportional to the number of resistance genes, but depend on specific genetic elements and their interactions with both the bacterial genome and the environment.

What statistical approaches are appropriate for analyzing bacterial persistence data?

Analyzing bacterial persistence data requires statistical methods tailored to the characteristics of microbial survival in environmental matrices. Based on established statistical practices, the following approaches provide a robust framework for analyzing S. heidelberg persistence data:

  • Survival and time-to-event analysis:

    • Apply Kaplan-Meier survival analysis to visualize persistence patterns over time

    • Implement log-rank tests to compare survival curves between different strains

    • Use Cox proportional hazards models to identify factors affecting survival rates

    • Consider accelerated failure time models for parametric analysis of survival data

  • Regression models for die-off kinetics:

    • Fit log-linear models to calculate first-order die-off rates (k values)

    • Apply biphasic models if die-off rates change over the experimental period

    • Use non-linear regression to fit Weibull or Gompertz models for non-log-linear decay patterns

    • Calculate D-values (decimal reduction times) to quantify persistence in standardized terms

  • Multivariate analysis for environmental correlations:

    • Perform correlation analysis between bacterial counts and environmental factors such as water activity

    • Implement principal component analysis to identify patterns across multiple variables

    • Use multiple regression to quantify the contribution of different environmental factors to persistence

    • Consider partial least squares regression for datasets with many potentially correlated predictors

  • Longitudinal data analysis:

    • Apply mixed-effects models to account for repeated measures over time

    • Implement generalized estimating equations for population-averaged effects

    • Use time-series analysis methods to identify temporal patterns in survival data

    • Consider autoregressive models to account for temporal autocorrelation

When applied to S. heidelberg persistence data, these statistical approaches can reveal important patterns that might otherwise remain obscured. For example, correlation analysis can quantify the relationship between water activity and bacterial survival, while survival analysis can identify significant differences in persistence between strains with different antimicrobial resistance profiles .

How can researchers integrate genomic and phenotypic data to understand virulence mechanisms?

Integrating genomic and phenotypic data is essential for developing a comprehensive understanding of virulence mechanisms in bacterial pathogens like S. heidelberg. Based on successful research approaches, the following methodological framework addresses key strategies for effective data integration:

  • Comparative genomics with phenotypic correlation:

    • Compare whole genome sequences of strains with different virulence phenotypes

    • Identify genetic differences (gene presence/absence, SNPs, structural variations)

    • Develop statistical methods to correlate specific genetic elements with observed phenotypic differences

    • Implement genomic island analysis to identify horizontally acquired virulence factors

  • Transcriptomic analysis linked to virulence:

    • Perform RNA-sequencing under conditions relevant to the infection process

    • Compare gene expression profiles between strains with different virulence levels

    • Identify differentially expressed genes related to virulence factors

    • Correlate expression patterns with phenotypic characteristics using appropriate statistical methods

  • Functional validation of genetic determinants:

    • Prioritize candidate virulence genes based on integrated genomic and transcriptomic data

    • Generate knockout mutants for these candidate genes

    • Complement mutants to confirm gene function

    • Assess the impact on virulence-associated phenotypes using standardized assays

  • Multimodal data integration techniques:

    • Apply systems biology approaches to integrate genomic, transcriptomic, and phenotypic datasets

    • Implement network analysis to identify functional modules associated with virulence

    • Use machine learning methods to identify patterns across multiple data types

    • Develop predictive models linking genetic features to virulence phenotypes

This integrated approach was successfully applied in research comparing two S. heidelberg variants from a bovine outbreak. Researchers combined whole genome sequencing, RNA-sequencing, and cellular invasion assays to identify genetic differences and expression patterns associated with increased pathogenicity . They found that the more pathogenic strain (SX 245) showed higher expression of fimbriae-related, flagella-related, and chemotaxis genes compared to the less pathogenic strain (SX 244), and displayed enhanced invasion of both human and bovine epithelial cells .

By integrating these multiple data types, researchers developed a model where genes involved in type 1 fimbriae production, flagellar regulation and biogenesis, and chemotaxis contributed to the increased pathogenicity and host range expansion of S. heidelberg in the bovine outbreak . This exemplifies how an integrated approach can provide deeper insights into virulence mechanisms than any single data type alone, highlighting the value of comprehensive data integration strategies in pathogen research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.