Recombinant Salmonella heidelberg Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Biological Role in Cell Envelope Integrity

YciB is a small inner membrane protein critical for maintaining cell envelope homeostasis :

  • Synergy with DcrB: In E. coli, YciB and lipoprotein DcrB act synergistically to prevent toxic linkages between peptidoglycan (PGN) and mislocalized outer membrane lipoproteins (e.g., Lpp) . Deleting both genes causes membrane vesiculation, impaired lipoprotein maturation, and cell lysis .

  • Lipoprotein Maturation: YciB supports the first step of lipoprotein processing by phosphatidylglycerol:preprolipoprotein diacylglyceryl transferase (Lgt). Defects in YciB impair Lgt activity, leading to stalled lipoproteins at the inner membrane .

  • Stress Response: Loss of YciB activates envelope stress responses (Cpx and Rcs pathways), indicating its role in mitigating membrane perturbations .

3.1. Mechanistic Studies

  • Cell Division: YciB’s homology to septation proteins suggests involvement in coordinating cell division with envelope biogenesis .

  • Antimicrobial Resistance (AMR): While not directly linked to AMR genes (e.g., blaCTX-M*), YciB’s role in membrane integrity may indirectly influence stress tolerance in multidrug-resistant S. Heidelberg .

3.2. Vaccine Development

Recombinant YciB is marketed as a candidate antigen for salmonellosis vaccines due to its surface exposure and conserved epitopes .

Genomic and Proteomic Insights

  • Operon Context: In Salmonella, yciB is part of a conserved genomic region distinct from the yciGFEkatN operon regulated by σS .

  • Transcriptional Regulation: YciB expression is upregulated under stress conditions, as seen in RNA-seq studies of antibiotic-resistant S. Heidelberg .

Key Research Findings

Study FocusKey OutcomeSource
YciB/DcrB synthetic lethalityDouble deletion causes lethal PGN-inner membrane linkages and vesiculation
Membrane fluidity defectsdcrB mutants fail to grow at low temperatures without YciB
Recombinant YciB productionOptimized in E. coli for structural and functional studies
Stress response in S. HeidelbergUpregulation of efflux pumps/heat shock proteins in YciB-expressing strains

Future Directions

  • Structural Studies: High-resolution crystallography to resolve YciB’s interaction with Lgt/DcrB.

  • Therapeutic Targeting: Explore YciB inhibition as a strategy to disrupt envelope integrity in multidrug-resistant Salmonella.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on your location and purchase method. Please contact your local distributor for specific delivery timeframe.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquotting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yciB; SeHA_C1925; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, ensuring the integrity of the cell envelope and maintaining membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are optimal for producing recombinant Salmonella heidelberg yciB protein?

    Recombinant yciB protein can be produced using several expression systems, with E. coli being the most commonly used. The methodological approach should consider:

    1. E. coli expression system: Most commercial versions of this protein utilize E. coli, which allows for high-yield production suitable for most research applications .

    2. Alternative expression systems: For specialized applications, yeast, baculovirus, or mammalian cell systems may be considered, though these are less common for bacterial membrane proteins .

    3. Vector design considerations: Vectors should incorporate:

      • Strong, inducible promoters (T7, tac)

      • Appropriate fusion tags for purification (His-tag is commonly used)

      • Signal sequences if necessary for membrane protein processing

    4. Extraction protocols: As a membrane protein, specialized extraction protocols using detergents are essential for maintaining native structure.

  • What are the optimal storage conditions for maintaining recombinant yciB protein stability?

    Based on manufacturer recommendations for commercially available recombinant yciB protein:

    1. Long-term storage: Store at -20°C or -80°C for extended periods.

    2. Working solution storage: Store aliquots at 4°C for up to one week.

    3. Buffer composition: Optimal storage buffer typically includes:

      • Tris-based buffer (pH 7.5-8.0)

      • 50% glycerol as cryoprotectant

      • Protein-specific stabilizing additives

    4. Handling precautions: Repeated freeze-thaw cycles should be avoided as they degrade protein structure and function .

    Research methodology: Protein stability should be verified after storage using methods such as SDS-PAGE, circular dichroism spectroscopy, or functional assays specific to membrane proteins.

Advanced Research Questions

  • What methodologies can be used to investigate the role of yciB in Salmonella heidelberg pathogenesis?

    While specific research on yciB's role in pathogenesis is limited, studies on Salmonella Heidelberg virulence provide methodological frameworks that can be applied:

    1. Gene knockout and complementation studies:

      • Generate clean deletion mutants of yciB using lambda-Red recombineering

      • Create complementation strains with inducible or constitutive expression

      • Compare phenotypes in infection models

    2. Infection models:

      • Cell culture invasion assays using epithelial cell lines

      • Intestinal organoid models for host-pathogen interactions

      • Animal models (particularly poultry) to study colonization and persistence

    3. Transcriptomic analysis:

      • RNA-seq to identify genes co-regulated with yciB during infection conditions

      • Comparison of wild-type vs. ΔyciB strain transcriptomes during stress conditions

      • Analysis of yciB expression under conditions simulating food processing environments

    4. Protein interaction studies:

      • Bacterial two-hybrid screening for protein-protein interactions

      • Co-immunoprecipitation combined with mass spectrometry

      • Crosslinking studies to identify interaction partners in vivo

    Studies have shown that Salmonella Heidelberg exhibits enhanced stress tolerance and virulence capabilities, with some strains demonstrating increased heat tolerance and biofilm-forming abilities . Investigating whether yciB contributes to these phenotypes would be valuable.

  • How can researchers investigate potential relationships between yciB function and antimicrobial resistance in Salmonella Heidelberg?

    Salmonella Heidelberg has shown concerning trends in antimicrobial resistance, particularly against extended-spectrum cephalosporins . To investigate yciB's potential role:

    1. Comparative genomics approach:

      • Analyze yciB sequence variations across resistant and susceptible isolates

      • Identify potential correlations between yciB mutations and resistance profiles

      • Examine co-occurrence patterns with known resistance determinants

    2. Phenotypic characterization:

      • Compare minimum inhibitory concentrations (MICs) between wild-type and ΔyciB strains

      • Evaluate biofilm formation capabilities, which can contribute to resistance

      • Assess membrane permeability differences using fluorescent dyes

    3. Gene expression studies:

      • Quantify yciB expression changes in response to antibiotic exposure

      • Determine if yciB knockout affects expression of efflux pumps or other resistance mechanisms

      • RNA-seq analysis comparing transcriptional responses to antibiotics in wild-type vs. mutant strains

    4. Complementation experiments:

      • Restore yciB in knockout strains to confirm phenotypic effects

      • Introduce specific mutations to identify functional domains relevant to resistance

    Recent research has identified decreased susceptibility to tobramycin, kanamycin, gentamicin, neomycin, and fosfomycin in some Salmonella Heidelberg strains , providing a foundation for investigating whether membrane proteins like yciB contribute to these resistance profiles.

  • What experimental design would be appropriate for studying yciB's role in Salmonella Heidelberg survival in poultry environments?

    Poultry environments represent a primary reservoir for Salmonella Heidelberg . A comprehensive experimental approach would include:

    1. Controlled laboratory experiments:

      • Compare survival of wild-type and ΔyciB strains in poultry litter under controlled conditions

      • Evaluate microevolution of strains over time (similar to approaches in Oladeinde et al., 2018)

      • Assess competitive fitness through mixed-culture experiments

    2. Gene expression analysis:

      • RNA-seq to identify differential gene expression in poultry litter conditions

      • RT-qPCR validation of yciB expression under specific stressors found in poultry environments

      • Promoter-reporter fusions to monitor expression in real-time

    3. Stress response characterization:

      • Heat tolerance assays (significant for Salmonella Heidelberg outbreaks)

      • Desiccation resistance testing

      • Antimicrobial compound tolerance relevant to poultry production

    4. Host interaction models:

      • Intestinal epithelial cell adhesion and invasion assays

      • Ex vivo chicken intestinal models

      • In vivo colonization studies in poultry

    Research has demonstrated that specific genetic elements contribute to enhanced fitness of Salmonella Heidelberg in poultry litter . Understanding if yciB is among these fitness determinants would provide valuable insights for control strategies.

  • How can structural biology approaches be applied to understand yciB function in Salmonella Heidelberg?

    As a membrane protein, yciB presents significant challenges for structural characterization. A comprehensive methodological approach would include:

    1. Computational structure prediction:

      • Homology modeling using related proteins with known structures

      • Ab initio modeling approaches for unique structural elements

      • Molecular dynamics simulations to predict membrane interactions

    2. Experimental structure determination:

      • X-ray crystallography of purified protein (challenging for membrane proteins)

      • Cryo-electron microscopy for larger complexes involving yciB

      • NMR spectroscopy for dynamic structural information

    3. Structure-function analysis:

      • Site-directed mutagenesis of predicted functional residues

      • Truncation studies to identify essential domains

      • Chimeric protein approaches with related bacterial proteins

    4. Protein-lipid interaction studies:

      • Lipid binding assays to determine membrane preferences

      • Reconstitution in artificial membrane systems

      • Fluorescence approaches to monitor membrane dynamics

    The amino acid sequence of yciB suggests multiple transmembrane domains , providing a starting point for structural predictions that can guide experimental approaches.

  • What transcriptomic approaches can reveal yciB regulation in Salmonella Heidelberg under different environmental conditions?

    Understanding yciB regulation requires comprehensive transcriptomic analysis under conditions relevant to Salmonella Heidelberg ecology and pathogenesis:

    1. RNA-seq experimental design:

      • Compare transcriptomes across conditions relevant to food processing (heat stress, sanitizers)

      • Analyze expression during host cell interaction models

      • Examine regulation during growth in poultry litter and intestinal environments

    2. Transcriptional start site mapping:

      • 5' RACE to identify precise transcriptional start sites

      • Differential RNA-seq to distinguish primary from processed transcripts

      • Promoter mapping through reporter fusions

    3. Regulatory network analysis:

      • ChIP-seq to identify transcription factors binding to yciB promoter

      • Genetic screens to identify regulators affecting yciB expression

      • Pathway analysis to place yciB in broader stress response networks

    4. Cross-strain comparative transcriptomics:

      • Compare yciB expression between outbreak and non-outbreak strains

      • Analyze transcriptional differences between antibiotic-resistant and susceptible isolates

      • Evaluate expression patterns across different Salmonella serovars

    Previous transcriptomic studies have shown that Salmonella Heidelberg isolates associated with outbreaks may be "transcriptionally primed" to better survive processing stresses and potentially cause illness , suggesting that analyzing yciB regulation in this context could provide valuable insights.

  • How can interspecies competition models be used to study yciB function in the context of microbial ecology?

    Recent research has shown that commensal bacteria can modulate the fitness and virulence of Salmonella Heidelberg . To investigate yciB's role in these interactions:

    1. Competition assay design:

      • Co-culture experiments with wild-type and ΔyciB Salmonella Heidelberg competing with commensal bacteria

      • In vitro gut microbiome models with defined communities

      • Spatial organization studies using microfluidic devices

    2. Transcriptomic analysis of competition:

      • Dual RNA-seq to simultaneously capture Salmonella and competitor transcriptomes

      • Analysis of yciB expression changes during competition

      • Identification of bacterial signals that regulate yciB expression

    3. Metabolic interaction studies:

      • Metabolomic profiling during competition

      • Stable isotope probing to track nutrient flows

      • Analysis of secreted factors affecting yciB expression or function

    4. In vivo competition models:

      • Gnotobiotic animal models with defined microbial communities

      • Selective isolation techniques to recover competing species

      • Fluorescent labeling for microscopic tracking of spatial relationships

    Studies have demonstrated that commensal E. coli can downregulate genes associated with virulence, transmembrane transport, and antimicrobial resistance in Salmonella Heidelberg , providing a foundation for investigating whether yciB is involved in these interactions.

  • What methodological approaches can identify host cell factors that interact with Salmonella Heidelberg yciB during infection?

    Identifying host-pathogen interactions involving yciB requires multidisciplinary approaches:

    1. Yeast two-hybrid and related screening methods:

      • Split-ubiquitin yeast two-hybrid (suitable for membrane proteins)

      • Bacterial two-hybrid screening against host protein libraries

      • Affinity purification coupled with mass spectrometry

    2. Microscopy-based approaches:

      • Fluorescence co-localization studies in infected cells

      • Super-resolution microscopy to visualize nanoscale interactions

      • Live-cell imaging to track dynamics during infection

    3. Functional genomics in host cells:

      • CRISPR screens to identify host factors affecting yciB-expressing bacteria

      • siRNA knockdown of candidate interacting proteins

      • Overexpression studies to validate functional interactions

    4. Biochemical validation methods:

      • Co-immunoprecipitation from infected cells

      • Biolayer interferometry or surface plasmon resonance for binding kinetics

      • Protein complementation assays in cellular contexts

    The highly invasive nature of Salmonella Heidelberg infections suggests that membrane proteins like yciB may have important interactions with host cell components during the infection process.

Table 1: Salmonella Heidelberg yciB Protein Characteristics

FeatureDescriptionReference
UniProt IDB4TJL7
Length179 amino acids
Molecular FunctionProbable intracellular septation protein
Cellular LocationMembrane-integrated
Expression Region1-179 (full length)
Ordered Locus NameSeHA_C1925

Table 2: Recommended Storage Conditions for Recombinant yciB Protein

Storage PurposeTemperatureDurationNotes
Long-term storage-20°C to -80°CMonths to yearsIn 50% glycerol
Working aliquots4°CUp to one weekAvoid repeated freeze-thaw
Shipping/TransportLyophilized or on iceShort-termReconstitute in deionized water

Table 3: Relevant Salmonella Heidelberg Research Findings

Research AreaKey FindingsImplications for yciB ResearchReference
Stress ToleranceEnhanced heat tolerance in outbreak strainsMay involve membrane proteins like yciB in stress response
Antimicrobial ResistanceDecreased susceptibility to multiple antibiotics observedMembrane proteins could contribute to permeability barriers
Genetic FitnessColE1 plasmids contribute to fitness in poultry environmentsInteraction with chromosomal genes like yciB worth investigating
Virulence MechanismsTranscriptional priming for stress survival and virulenceRegulatory networks may include yciB
Microbial CompetitionCommensal E. coli can downregulate virulence genesMay affect membrane protein expression including yciB

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.