Recombinant Salmonella heidelberg Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
crcB; SeHA_C0745; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWMLSMRFNPLHQAIPIGTLTANLLGAFIIGMGFAWFNRMTH IDPMWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVLINLLGSFAMTALAFWL FSAAAAR
Uniprot No.

Target Background

Function

Crucial for reducing intracellular fluoride concentration and its associated toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does the CrcB protein function in bacterial systems?

    The CrcB protein functions primarily as a membrane-associated fluoride ion transporter that helps reduce cellular concentrations of this potentially toxic anion. Research methodologies to study this function include:

    • Genetic knockout studies that demonstrate increased fluoride sensitivity in CrcB-deficient strains

    • Reporter construct assays measuring gene expression in response to fluoride exposure

    • Growth curve analyses comparing wild-type and knockout cells at various fluoride concentrations

    Studies have demonstrated that strains carrying genetic knockouts of crcB genes cannot grow at elevated fluoride concentrations (e.g., 50 mM) and exhibit high reporter gene expression even at low fluoride concentrations (0.2 mM), confirming the protein's role in fluoride resistance . Beyond fluoride transport, early literature also implicated crcB genes in chromosome condensation and camphor resistance, suggesting potential multifunctional properties .

  • What expression systems are commonly used for recombinant production of CrcB?

    The most widely employed expression system for recombinant production of Salmonella heidelberg CrcB homolog is E. coli. The methodological approach typically involves:

    1. Cloning the crcB gene (encoding amino acids 1-127) into an expression vector with an N-terminal His tag

    2. Transformation into an E. coli expression strain

    3. Induction of protein expression under controlled conditions

    4. Cell lysis and protein purification via affinity chromatography

    5. Final preparation as a lyophilized powder in a stabilizing buffer (often Tris/PBS-based with 6% trehalose, pH 8.0)

    For optimal storage and activity, the purified protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage at -20°C/-80°C. Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

Advanced Research Questions

  • How do CrcB homologs differ across various Salmonella strains, and what methodologies are appropriate for comparative analysis?

    Comparative analysis of CrcB homologs across Salmonella strains reveals striking sequence conservation despite strain diversity. For example, the CrcB proteins from Salmonella dublin, Salmonella heidelberg, and Salmonella gallinarum share identical 127-amino acid sequences .

    Methodological approaches for comparative analysis include:

    • Multiple sequence alignment of CrcB proteins from different Salmonella serovars

    • Phylogenetic analysis to establish evolutionary relationships

    • Comparative genomic analysis to examine gene context and synteny

    • Functional complementation studies to assess conserved activity

    Research has shown that while the protein sequence is highly conserved, the genomic context may vary. Researchers should employ bioinformatic tools such as BLAST, Clustal Omega for alignments, and MEGA for phylogenetic reconstruction to fully characterize these relationships. Functional studies comparing fluoride resistance capabilities across strains can provide insights into potential specialized adaptations .

  • What are the experimental challenges in elucidating the three-dimensional structure of CrcB, and how can they be addressed?

    Determining the three-dimensional structure of membrane proteins like CrcB presents several significant challenges:

    1. Protein purification challenges:

      • Maintaining native conformation during extraction from membranes

      • Obtaining sufficient quantities of pure, homogeneous protein

      • Preventing aggregation during concentration steps

    2. Methodological approaches to address these challenges:

      • Use of specialized detergents or nanodiscs to maintain membrane protein structure

      • Optimization of expression conditions to increase yield (temperature, induction time)

      • Screening multiple constructs with varying tags and fusion partners

      • Employing lipid cubic phase crystallization techniques specifically designed for membrane proteins

      • Considering cryo-electron microscopy as an alternative to X-ray crystallography

    3. Validation approaches:

      • Functional assays to confirm that purified protein retains fluoride transport activity

      • Circular dichroism to verify secondary structure elements

      • Size exclusion chromatography to assess homogeneity and oligomeric state

    Researchers should consider collaborating with structural biology specialists and utilizing facilities equipped with advanced instrumentation for membrane protein crystallography or cryo-EM .

  • How can Recombinant Salmonella heidelberg CrcB be utilized in vaccine development research?

    Recombinant Salmonella strains can serve as effective vaccine vectors due to their ability to invade and colonize deep effector lymphoid tissues after mucosal delivery. The methodological framework for utilizing CrcB in this context includes:

    1. Attenuation strategies:

      • Deletion of virulence genes (crp/cya) while maintaining immunogenicity

      • Regulation of gene expression using araC PBAD promoter systems

      • Employment of balanced-lethal vector-host systems for plasmid stability without antibiotic resistance markers

    2. Antigenic display approaches:

      • Fusion of heterologous antigens to CrcB for surface display

      • Co-expression with immunogenic epitopes

      • Regulated delayed synthesis of recombinant protective antigens

    3. Evaluation methodology:

      • Assessment of specific IgG production against target antigens

      • Challenge studies to determine protection efficacy

      • Analysis of T-cell responses via ELISpot or flow cytometry

    Research has demonstrated that recombinant attenuated Salmonella vaccines (RASVs) can induce protective immunity against homologous challenges and provide significant heterologous protection, making them promising platforms for vaccine development .

  • What methodologies are most effective for studying CrcB's role in fluoride transport at the molecular level?

    Investigating CrcB's fluoride transport mechanisms requires sophisticated approaches:

    1. Biophysical transport assays:

      • Liposome reconstitution with purified CrcB

      • Fluoride-selective electrode measurements

      • Fluorescent indicator dyes for real-time transport monitoring

      • Isothermal titration calorimetry to determine binding affinities

    2. Structural biology approaches:

      • Site-directed mutagenesis of potential fluoride-binding residues

      • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

      • Molecular dynamics simulations to predict ion movement pathways

    3. Genetic and cellular approaches:

      • CRISPR-Cas9 genome editing to create specific mutations

      • Fluoride riboswitch reporter systems to monitor intracellular fluoride levels

      • Growth inhibition assays comparing wild-type and mutant strains

    Research has established that crcB genes are associated with fluoride riboswitches, suggesting coordinated regulation of fluoride detection and export mechanisms. Understanding the selective recognition of fluoride by these systems is crucial, particularly given fluoride's unique properties including small ionic radius (0.133 nm compared to chloride's 0.181 nm) and distinctive hydrogen-bonding capabilities .

  • How does the expression of CrcB correlate with antibiotic resistance profiles in Salmonella heidelberg isolates?

    The relationship between CrcB expression and antibiotic resistance in Salmonella heidelberg requires systematic investigation:

    1. Correlation analysis methodologies:

      • Transcriptomic profiling (RNA-seq) to measure crcB expression levels

      • Minimum inhibitory concentration (MIC) determination for various antibiotics

      • Statistical correlation between expression and resistance phenotypes

    2. Functional validation approaches:

      • Overexpression and knockout studies to establish causality

      • Complementation assays to confirm specificity

      • Time-kill kinetics to assess dynamic resistance properties

    Comparative genomic studies of Salmonella heidelberg isolates have revealed varying antibiotic resistance profiles, with some strains carrying genes associated with resistance to cephalosporins, tetracyclines, and streptomycin. The table below summarizes findings from environmental isolates:

    SourceResistance GenesPrevalence
    Chicken farmsCephalosporin, tetracycline, streptomycin resistance genes21% (4/19)
    Turkey farmsSpectinomycin and sulfonamide resistance genes67% (8/12)

    Notably, in silico predictions of antibiotic resistance genes using databases like CARD and ARBD sometimes show discrepancies with antimicrobial susceptibility assays, highlighting the need for combined phenotypic and genotypic approaches in resistance studies .

  • What are the current challenges in developing fluoride-binding assays for CrcB, and how can they be overcome?

    Developing reliable fluoride-binding assays for CrcB presents several technical challenges:

    1. Methodological challenges:

      • Distinguishing specific fluoride binding from non-specific interactions

      • Maintaining protein stability during assay conditions

      • Achieving sufficient sensitivity for low-affinity interactions

    2. Innovative approaches:

      • Fluorescence-based assays using environment-sensitive probes

      • Surface plasmon resonance with immobilized CrcB

      • Microscale thermophoresis for detecting binding-induced changes

      • In-line probing to assess fluoride-induced conformational changes in associated riboswitches

    3. Validation strategies:

      • Competition assays with other anions to confirm specificity

      • Correlation of binding with transport activity

      • Mutagenesis of predicted binding sites

    Research has demonstrated that RNA molecules can form fluoride-specific pockets without cofactors, potentially exploiting fluoride's unique ionic radius and hydrogen-bonding properties. Similar principles may apply to CrcB's selective recognition mechanisms. In-line probing methods have successfully revealed extensive conformational changes in crcB motif RNAs upon fluoride binding, providing a foundation for protein-based assay development .

  • How can researchers effectively study the regulation of crcB gene expression in Salmonella heidelberg?

    Understanding crcB regulation requires multi-faceted approaches:

    1. Transcriptional regulation methodologies:

      • Promoter mapping using 5' RACE and reporter fusions

      • ChIP-seq to identify transcription factor binding sites

      • RNA-seq under various environmental conditions (pH, fluoride concentration, stress)

    2. Post-transcriptional regulation approaches:

      • Analysis of fluoride riboswitches and their binding kinetics

      • Investigation of sRNA-mediated regulation

      • Measurement of mRNA stability and decay rates

    3. Environmental response characterization:

      • qRT-PCR to quantify expression changes under stress conditions

      • Fluorescent reporter strains for real-time monitoring

      • Proteomics to correlate transcript and protein levels

    Research has identified that crcB genes are commonly associated with fluoride riboswitches, which can regulate gene expression in response to fluoride levels. Reporter constructs created by joining representative riboswitches to reporter genes have demonstrated that these regulatory elements respond selectively to fluoride and not to other anions, suggesting sophisticated control mechanisms for crcB expression .

Research Methodology Questions

  • What protein purification strategies yield the highest quality recombinant CrcB for structural and functional studies?

    Optimizing purification of recombinant CrcB requires specialized approaches for membrane proteins:

    1. Extraction optimization:

      • Systematic screening of detergents (DDM, LMNG, CHAPS)

      • Evaluation of solubilization efficiency and functional retention

      • Consideration of native nanodiscs or styrene maleic acid copolymer lipid particles (SMALPs)

    2. Purification workflow:

      • Immobilized metal affinity chromatography (IMAC) using His-tag

      • Size exclusion chromatography to remove aggregates

      • Ion exchange chromatography for final polishing

      • Detergent exchange during purification if needed for downstream applications

    3. Quality assessment metrics:

      • SDS-PAGE with Coomassie staining (target: >90% purity)

      • Western blotting to confirm identity

      • Dynamic light scattering to assess homogeneity

      • Circular dichroism to evaluate secondary structure integrity

    Recombinant CrcB is typically provided as a lyophilized powder with >90% purity as determined by SDS-PAGE. For reconstitution and storage, researchers should follow specific protocols: briefly centrifuge the vial before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, add glycerol to a final concentration of 5-50%, and store in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

  • What experimental design approaches are most effective for studying CrcB function in different bacterial environments?

    Comprehensive functional characterization of CrcB requires systematic experimental designs:

    1. Complementation study design:

      • Construction of crcB knockout strains in multiple Salmonella serovars

      • Complementation with wild-type and mutant variants

      • Phenotypic assessment under varying fluoride concentrations

      • Growth curve analysis and survival rate determination

    2. Heterologous expression approaches:

      • Expression in fluoride-sensitive bacterial species

      • Creation of chimeric proteins to map functional domains

      • Inducible expression systems for dose-dependent studies

    3. Environmental variable testing:

      • Systematic evaluation of pH, temperature, and ionic strength effects

      • Assessment of function under various stress conditions

      • Competition assays between wild-type and mutant strains

    Research has demonstrated that E. coli strains with genetic knockouts of crcB show growth inhibition at fluoride concentrations that do not affect wild-type cells. Such experimental designs have established CrcB's role in fluoride resistance and can be extended to study function across different bacterial environments and species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.