Recombinant Salmonella heidelberg Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Production and Purification Protocol

Optimized protocols for recombinant GlpG production derive from methodologies established for homologous proteases :

  • Expression: Induced in E. coli using IPTG or arabinose-based systems, with yields of 1–2.5 mg per liter of culture .

  • Solubilization: Detergents like n-dodecyl-β-D-maltoside (DDM) preserve enzymatic activity during membrane extraction .

  • Purification: Nickel affinity chromatography followed by size-exclusion chromatography (SEC) achieves >90% purity .

Storage conditions recommend Tris-based buffers with 50% glycerol at -20°C or -80°C to maintain stability .

Applications in Research

Recombinant GlpG serves as a model for studying intramembrane proteolysis mechanisms:

  • Structural Studies:

    • Crystal structures of homologous GlpG proteases reveal a hydrophilic cavity accommodating substrate TMDs .

  • Drug Discovery:

    • Inhibitors targeting GlpG’s catalytic serine disrupt biofilm formation, suggesting therapeutic potential .

Challenges and Future Directions

  • Substrate Identification: Cleavage specificity remains poorly understood due to conditional expression and partner protein dependencies .

  • Evolutionary Conservation: Functional overlap with Tat secretion systems hints at ancient quality control mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes for personalized preparation.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize development based on your request.
Synonyms
glpG; SeHA_C3832; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella heidelberg Rhomboid protease glpG and what is its biological function?

Salmonella heidelberg Rhomboid protease glpG (glpG) is an intramembrane serine protease that belongs to the rhomboid family of proteases. Its primary biological function involves membrane protein quality control by selectively targeting orphan components of multiprotein complexes, particularly respiratory complexes. GlpG contributes significantly to membrane proteostasis by initiating the degradation of proteins that are not properly incorporated into their respective functional complexes .

The protease contains a catalytic dyad (Ser201/His254) embedded approximately 10 Å below the membrane surface. This structural arrangement enables GlpG to recognize and cleave transmembrane domains (TMDs) of its substrates within the lipid bilayer . The cleaved substrates can then undergo further degradation by other proteases, demonstrating that GlpG plays a crucial initiating role in a broader degradation pathway for orphan membrane proteins.

How should recombinant GlpG be reconstituted for experimental use?

For optimal reconstitution of lyophilized recombinant GlpG protein:

  • Centrifuge the vial briefly prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the standard recommended concentration)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

Important storage considerations include:

  • Avoiding repeated freeze-thaw cycles, which can significantly reduce protein activity

  • Storing working aliquots at 4°C for no more than one week

  • Maintaining the protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

What experimental approaches can be used to identify and validate substrates of GlpG?

Identifying and validating substrates of GlpG involves several complementary experimental approaches:

  • TMD analysis for substrate prediction: Scanning for transmembrane domains containing helix-destabilizing residues (particularly prolines) which are characteristic features of rhomboid substrates .

  • Comparative expression systems: Expressing GlpG alongside candidate substrates in systems lacking endogenous rhomboid activity. This can be achieved by:

    • Creating deletion strains (ΔglpG) complemented with plasmid-encoded active (wild-type) or inactive (S201A) versions of the protease

    • Comparing substrate cleavage patterns between active and inactive enzyme conditions

  • Western blot detection: Tagging potential substrates (e.g., with sfCherry-3xFLAG) to allow detection of full-length proteins and cleavage products .

  • N-terminal sequencing: Mapping precise cleavage sites by sequencing the N-terminus of cleavage products. For example, Gly296 was identified as the P1 residue in HybA cleavage by GlpG .

  • Site-directed mutagenesis: Validating substrate recognition by mutating key residues:

    • Substituting the P1 residue with bulky amino acids (e.g., HybA G296F)

    • Mutating helix-destabilizing prolines (e.g., HybA P300A)

    • Confirming cleavage resistance of the mutated substrates

What environmental conditions affect GlpG activity and should be considered in experimental design?

Several environmental conditions significantly impact GlpG activity and substrate expression:

  • Oxygen levels: Many GlpG substrates, such as components of hydrogenase-2 (Hyd-2) and formate dehydrogenases, are only expressed under anaerobic conditions. For example, HybA cleavage should be assessed under anaerobic conditions for physiologically relevant results .

  • Growth medium composition: The medium can affect expression of respiratory complexes:

    • LB supplemented with nitrate for formate dehydrogenase N expression

    • LB supplemented with glycerol and fumarate for other respiratory complexes

  • Metabolic stress conditions: Copper stress, which perturbs Fe-S clusters, can influence the stability and processing of substrates such as FdoH and FdnH .

  • Translation inhibition: Adding chloramphenicol to block de novo protein translation can help monitor the degradation kinetics of cleaved substrates .

  • Temperature: Standard conditions for E. coli-expressed proteins apply, but specific temperature dependencies of GlpG activity should be evaluated for each experimental setup.

How does GlpG distinguish between orphan proteins and those properly incorporated into multiprotein complexes?

GlpG exhibits remarkable specificity for orphan membrane proteins through a sophisticated recognition mechanism:

  • TMD accessibility: When proteins are incorporated into multiprotein complexes, their potentially cleavable TMDs may be shielded from rhomboid access by interactions with partner proteins. For instance, HybA is protected from GlpG cleavage when properly assembled in the hydrogenase-2 complex .

  • Substrate conformational changes: Orphan proteins may adopt different conformations than when assembled in complexes, potentially exposing helix-destabilizing residues or cleavage sites that are otherwise hidden.

  • Sequential proteolysis model: The evidence indicates that rhomboid-mediated proteolysis occurs through distinct stages:

    • Initial formation of an "interrogation complex" when the TMD engages with GlpG

    • Transition to a "scission complex" requiring unwinding of the substrate TMD

    • Cleavage occurring only when specific destabilizing residues are present

This demonstrates a sophisticated quality control system where GlpG functions as a sensor for improperly assembled membrane protein complexes, targeting only the orphan components for degradation.

What are the structural determinants of substrate recognition by GlpG?

Key structural features that determine substrate recognition by GlpG include:

  • Helix-destabilizing residues: Proline residues within the TMD are critical for recognition and cleavage. Mutation of these prolines (e.g., HybA P300A, FdnH P259A, FdoH P259A) renders substrates resistant to cleavage even when they exist as orphan proteins .

  • P1 residue characteristics: The C-terminal residue generated upon cleavage (P1) has specific requirements. Small amino acids are preferred, with glycine being common (e.g., Gly296 in HybA). Substitution with bulky residues (HybA G296F) prevents cleavage .

  • Evolutionary conservation: The helix-destabilizing prolines in substrate TMDs show conservation in orthologous proteins across phylogenetically distant bacterial species, suggesting fundamental importance to the recognition mechanism .

  • TMD unwinding requirement: The cleavage mechanism requires substrate TMD unwinding, which is facilitated by the helix-destabilizing residues. This represents a rate-limiting step in the proteolytic process .

SubstrateP1 ResidueKey Proline PositionEffect of Proline Mutation
HybAGly296Pro300P300A prevents cleavage
FdnHNot mappedPro259P259A prevents cleavage
FdoHNot mappedPro259P259A prevents cleavage

How does GlpG-mediated cleavage integrate with downstream degradation processes?

GlpG-mediated cleavage appears to initiate a sequential degradation pathway:

  • Initial licensing step: The rhomboid cleavage serves as an initial step that "licenses" the substrate for further degradation by other proteases. This is particularly evident with orphan HybA, which shows additional degradation products of lower molecular mass after GlpG cleavage .

  • Condition-dependent processing: The fate of cleaved substrates varies depending on environmental conditions:

    • HybA shows clear further degradation after GlpG cleavage

    • FdoH and FdnH exhibit additional degradation only under specific conditions (anaerobic growth with glycerol/fumarate plus copper stress)

  • Prevention of membrane aggregates: A proposed function of this degradation pathway is to prevent the accumulation of orphan membrane proteins, which could form potentially toxic aggregates in the membrane .

  • Proteostasis mechanism: This rhomboid-initiated degradation pathway represents an important quality control mechanism for maintaining membrane proteostasis, particularly for complex multiprotein assemblies like respiratory chains .

What is known about the relationship between Salmonella heidelberg GlpG and related rhomboid proteases like Rhom7?

The relationship between different rhomboid proteases reveals evolutionary and functional insights:

  • Structural similarities: Salmonella heidelberg GlpG shares significant sequence homology with Escherichia coli GlpG, while Rhom7 (another rhomboid in Shigella sonnei) shares homology with Providencia stuartii AarA .

  • Substrate overlap: GlpG and Rhom7 show partially overlapping substrate specificity:

    • Both cleave HybA and HybO (hydrogenase-2 components)

    • GlpG specifically cleaves FdoH (formate dehydrogenase O)

    • Rhom7 specifically cleaves FdnH (formate dehydrogenase N)

  • Unique structural features: Rhom7 has unique features including a 7th transmembrane domain (7thTMD) that is dispensable for cleavage of artificial substrates but may play roles in substrate recognition or regulation of proteolytic activity .

  • Evolutionary conservation: The presence of rhomboids across all domains of life suggests that this quality control mechanism represents an ancient and fundamental aspect of membrane protein regulation .

What experimental controls should be included when studying GlpG activity?

Proper experimental design for studying GlpG activity should include:

  • Catalytic site mutants: Using catalytically inactive GlpG (S201A) as a negative control to differentiate specific rhomboid-mediated cleavage from non-specific degradation .

  • Substrate mutants: Including substrate variants with mutations in key recognition elements:

    • P1 residue mutants (e.g., HybA G296F)

    • Helix-destabilizing residue mutants (e.g., HybA P300A)

  • Expression conditions: Ensuring appropriate conditions for substrate expression:

    • Anaerobic conditions for respiratory complex components

    • Appropriate supplements in growth media

  • Complex assembly controls: Comparing substrate processing in strains with or without partner proteins (e.g., FdoH with or without FdoI) to assess how complex assembly affects cleavage .

  • Protein synthesis inhibition: Using translation inhibitors like chloramphenicol to distinguish between reduced steady-state levels due to degradation versus reduced synthesis .

How can researchers effectively express and purify active recombinant GlpG for in vitro studies?

For successful expression and purification of active recombinant GlpG:

  • Expression system: E. coli is the recommended expression system, as demonstrated by the successful production of recombinant full-length Salmonella heidelberg Rhomboid protease glpG with N-terminal His tag .

  • Purification approach:

    • Affinity chromatography using His-tag for initial purification

    • Achieving >90% purity as determined by SDS-PAGE

  • Buffer considerations:

    • Final storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Addition of glycerol (5-50%, recommended 50%) for stability

  • Storage recommendations:

    • Long-term storage at -20°C/-80°C in aliquots

    • Working aliquots at 4°C for up to one week

    • Avoiding repeated freeze-thaw cycles

  • Activity verification: Confirming activity using known substrates or synthetic peptides containing validated cleavage sites (e.g., sequences derived from HybA containing the Gly296 cleavage site).

How can rhomboid protease activity be measured quantitatively in different experimental setups?

Quantitative assessment of rhomboid protease activity can be performed using several methodologies:

  • Western blot quantification:

    • Using tagged substrates (e.g., sfCherry-3xFLAG)

    • Measuring the ratio of cleaved to uncleaved substrate

    • Quantifying band intensities using densitometry software

  • Pulse-chase experiments:

    • Labeling newly synthesized proteins

    • Following the fate of labeled substrates over time

    • Measuring degradation rates in the presence of active versus inactive rhomboid

  • Fluorescence-based assays:

    • Designing FRET-based substrates spanning the cleavage site

    • Monitoring cleavage through increased fluorescence as FRET is disrupted

    • Allowing real-time measurement of proteolytic activity

  • Mass spectrometry approaches:

    • Identifying and quantifying cleavage products

    • Mapping precise cleavage sites

    • Monitoring changes in substrate abundance

  • In vitro reconstitution systems:

    • Purified components in lipid bilayers or detergent micelles

    • Direct measurement of purified substrate cleavage

    • Determining kinetic parameters through time-course experiments

What are the potential implications of GlpG's role in quality control for understanding bacterial physiology?

The discovery of GlpG's role in quality control of membrane proteins has significant implications:

  • Stress response mechanisms: The system may be particularly important during environmental stresses that affect protein folding and complex assembly, suggesting rhomboids could be part of bacterial stress response mechanisms.

  • Energy conservation: By eliminating non-functional orphan proteins from respiratory complexes, this quality control system may help maintain energy efficiency in bacterial metabolism .

  • Adaptation to changing environments: The selectivity for orphan proteins allows bacteria to rapidly eliminate unnecessary complexes when environmental conditions change, potentially facilitating adaptation .

  • Potential antimicrobial targets: Given the importance of membrane protein quality control for bacterial viability, rhomboid proteases might represent novel targets for antimicrobial development, particularly for pathogens like Salmonella.

  • Evolutionary conservation: The presence of this mechanism in evolutionarily ancient organisms suggests it represents a fundamental aspect of cellular quality control that may extend to eukaryotes as well .

How might techniques from structural biology advance our understanding of GlpG mechanism and specificity?

Advanced structural biology approaches could address key questions about GlpG:

  • Cryo-EM of substrate-enzyme complexes: Capturing the "interrogation complex" and "scission complex" states to understand the structural basis of substrate recognition and the unwinding mechanism.

  • Hydrogen-deuterium exchange mass spectrometry: Probing conformational changes in both enzyme and substrate during the recognition and cleavage process.

  • Single-molecule FRET studies: Investigating the dynamics of substrate engagement and processing in real-time.

  • Molecular dynamics simulations: Modeling the unwinding of substrate TMDs and interactions with the catalytic site to understand the energetics of the process.

  • Comparative structural analysis: Examining differences between GlpG and Rhom7 structures to understand their partially overlapping substrate specificities.

These approaches could help resolve fundamental questions about how GlpG achieves its remarkable specificity for orphan proteins and how the substrate TMD is unwound to access the catalytic site.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.