Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mdtI; SeHA_C1652; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
mdtI
Target Protein Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Uniprot No.

Target Background

Function

Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its primary function in Salmonella heidelberg?

MdtI is a protein that partners with MdtJ to form a functional spermidine excretion complex (MdtJI) in enterobacteria. While extensively characterized in Escherichia coli, the MdtI protein in Salmonella heidelberg likely functions similarly based on evolutionary conservation patterns among enterobacteria. The protein belongs to the small multidrug resistance (SMR) family of drug exporters and specifically functions to export spermidine from bacterial cells, preventing toxic accumulation of this polyamine .

The primary function involves maintaining polyamine homeostasis within the cell, as polyamines like spermidine are essential for normal cell growth but can become toxic when overaccumulated. Research has demonstrated that both mdtJ and mdtI genes are necessary for recovery from spermidine toxicity, indicating their cooperative function in polyamine excretion .

How does the MdtJI complex respond to changes in spermidine levels?

The MdtJI complex demonstrates an adaptive response to increased spermidine concentrations. Experimental evidence indicates that the expression level of mdtJI mRNA increases in the presence of elevated spermidine, suggesting a regulatory feedback mechanism that upregulates the excretion system when spermidine levels rise .

When bacterial cells are cultured in the presence of 2 mM spermidine, those expressing functional MdtJI show decreased intracellular spermidine content and enhanced spermidine excretion compared to control cells. This provides strong evidence that the MdtJI complex actively catalyzes the export of spermidine from the cell, serving as a protective mechanism against polyamine toxicity .

What key amino acid residues are essential for MdtI function?

Site-directed mutagenesis studies have identified several critical amino acid residues in the MdtI protein that are essential for its spermidine excretion activity. Specifically, the following residues in MdtI have been demonstrated to be functionally important:

  • Glu 5

  • Glu 19

  • Asp 60

  • Trp 68

  • Trp 81

These residues appear to be involved in substrate recognition, binding, or the conformational changes necessary for the transport mechanism . The presence of multiple acidic residues (Glu, Asp) suggests their importance in interacting with the positively charged polyamine substrate.

How can heterologous expression systems be optimized for studying recombinant MdtI from Salmonella heidelberg?

Optimization of heterologous expression systems for studying recombinant MdtI requires careful consideration of several factors. Based on experimental approaches used with related proteins, the following methodology is recommended:

  • Vector selection: Plasmids such as pUC derivatives have proven effective for MdtI expression in E. coli systems. When constructing expression vectors, it's crucial to include both mdtJ and mdtI genes, as they function cooperatively .

  • Host strain optimization: For functional studies, consider using strains deficient in spermidine acetyltransferase, which would allow clearer observation of MdtI function in spermidine export without interference from metabolic conversion of spermidine .

  • Induction conditions: Since mdtJI expression is regulated by spermidine levels, experimental design should account for this by testing various spermidine concentrations in the growth medium and monitoring corresponding changes in protein expression and function .

  • Protein purification strategy: Given that MdtI is a membrane protein, detergent-based extraction methods followed by affinity chromatography (using epitope tags like His-tag) represent effective approaches for protein isolation.

What experimental approaches can be used to measure spermidine export activity of the MdtJI complex in Salmonella heidelberg?

Multiple complementary approaches can be employed to quantify the spermidine export activity of recombinant MdtJI:

  • Cell toxicity assays: In strains deficient in spermidine metabolism, measure growth recovery in the presence of toxic spermidine concentrations when MdtJI is expressed versus when it is absent or mutated .

  • Radioactive spermidine uptake/efflux assays: Use radiolabeled spermidine (³H-spermidine) to quantitatively measure both uptake and efflux rates in cells expressing wild-type versus mutant MdtJI complexes.

  • HPLC-based quantification: High-performance liquid chromatography can be used to measure intracellular and extracellular polyamine concentrations, with decreased intracellular and increased extracellular spermidine levels indicating active export .

  • Fluorescent spermidine analogs: Develop and utilize fluorescently labeled spermidine analogs to visualize and quantify transport in real-time using fluorescence microscopy or flow cytometry.

  • Membrane vesicle transport assays: Prepare inside-out membrane vesicles from cells expressing MdtJI and measure ATP-dependent spermidine accumulation.

How do spermidine export mechanisms differ between multidrug-resistant and susceptible Salmonella strains?

Research on drug resistance in Salmonella provides context for investigating potential differences in spermidine export mechanisms:

In multidrug-resistant (MDR) Salmonella strains, particularly those of the DT104 phage type, altered membrane permeability and enhanced efflux pump expression are common resistance mechanisms . These changes may influence spermidine homeostasis in several ways:

  • Efflux system upregulation: MDR strains often show upregulated expression of various efflux systems. This general upregulation may extend to the MdtJI system, potentially enhancing spermidine export capacity.

  • Plasmid-mediated effects: Many MDR Salmonella strains carry resistance plasmids that may contain additional genes influencing membrane transport systems. Conjugation experiments, similar to those described for antibiotic resistance transfer, could be employed to determine if spermidine export capacity is affected by these plasmids .

  • Integron presence: MDR strains like DT104 typically contain class I integrons of specific sizes (1.0 and 1.2 kb) . These genetic elements might influence the regulation or function of transport systems including MdtJI.

A comparative study examining spermidine export activity in MDR versus susceptible strains would require:

  • Measurement of mdtJI expression levels using qRT-PCR

  • Functional assays comparing spermidine export rates

  • Analysis of growth inhibition under high spermidine conditions

  • Evaluation of potential regulatory interactions between resistance determinants and mdtJI expression

What Sequential Multiple Assignment Randomized Trial (SMART) design would be appropriate for studying MdtI function under varying conditions?

A SMART design offers advantages for studying adaptive interventions and could be applied to investigate MdtI function under varying environmental conditions. An appropriate SMART design for this research would entail:

  • Initial randomization: Assign bacterial cultures expressing recombinant MdtI to different initial spermidine concentrations (e.g., 0, 0.5, 1, and 2 mM).

  • Response assessment: After a defined period (e.g., 6 hours), measure growth inhibition and mdtJI expression levels to classify cultures as responders or non-responders.

  • Second randomization: Re-randomize cultures within each response category to different secondary interventions, such as:

    • For responders: Maintain current conditions or increase spermidine concentration

    • For non-responders: Add a membrane permeabilizer, introduce a plasmid with additional copies of mdtJI, or switch to an alternative polyamine

  • Final outcome assessment: Measure multiple endpoints including growth rates, spermidine export activity, and gene expression profiles .

This design allows for the systematic evaluation of different adaptive strategies for studying MdtI function and would provide insights into which experimental conditions optimize detection of spermidine export activity.

What micro-randomized trial approach could be used to study real-time regulation of MdtI expression?

A micro-randomized trial (MRT) design is particularly useful for studying interventions delivered multiple times in rapid succession, making it well-suited for investigating real-time regulation of MdtI expression:

  • Preparation of reporter system: Engineer a Salmonella strain containing a fluorescent protein reporter (e.g., GFP) under the control of the mdtJI promoter to monitor expression levels in real-time.

  • Sequential randomization: At frequent time intervals (e.g., every 30 minutes), randomly assign each culture to receive one of several interventions, such as:

    • Addition of different polyamines (spermidine, putrescine, cadaverine)

    • Exposure to various antibiotics known to affect membrane integrity

    • pH changes

    • Osmolarity shifts

  • Continuous monitoring: Track changes in fluorescence (indicating mdtJI promoter activity) using automated plate readers or microfluidic devices with time-lapse microscopy.

  • Data analysis: Employ statistical methods designed for MRTs to determine which factors most significantly influence mdtJI expression and with what temporal dynamics .

This approach allows for the identification of environmental triggers for mdtJI regulation and characterization of the temporal response patterns, providing insights into the adaptive regulation of this export system.

How should researchers interpret conflicting results between in vitro and in vivo studies of MdtI function?

When facing discrepancies between in vitro and in vivo studies of MdtI function, researchers should consider the following analytical framework:

  • Systematic comparison: Create a detailed comparison table documenting specific differences in experimental conditions:

ParameterIn Vitro SystemIn Vivo SystemPotential Impact on Results
Spermidine concentrationTypically controlled (0.5-2 mM)Variable, influenced by host metabolismMay affect induction levels of mdtJI
pH conditionsUsually neutralVariable (e.g., acidic in phagolysosomes)Could alter protein conformation or substrate binding
Competing transportersLimited in simplified systemsComplete complement in living organismsMay mask MdtI-specific effects
Protein expression levelsOften overexpressedNative expressionCould affect stoichiometry of complex formation
Membrane compositionSimplified in liposomes or E. coliNative in Salmonella heidelbergMay impact protein integration and function
  • Consider physiological context: In vivo systems contain regulatory networks absent in vitro. For example, expression of alternative transporters or metabolic enzymes may compensate for MdtI deficiency in vivo but not in vitro .

  • Evaluate methodological limitations: In vitro transport assays may not recapitulate the electrochemical gradients present in living cells, potentially affecting energetics of transport.

  • Apply integrative analysis: Use computational modeling to reconcile disparate datasets by identifying parameters that could explain observed differences.

What statistical approaches are most appropriate for analyzing MdtI mutant functionality data?

When analyzing the functional impact of MdtI mutations, several statistical approaches should be considered:

  • Dose-response modeling: For spermidine toxicity and export assays, use nonlinear regression to fit dose-response curves, comparing EC50 values and Hill coefficients between wild-type and mutant variants.

  • ANOVA with post-hoc tests: When comparing multiple mutants against wild-type MdtI:

    • Use one-way ANOVA followed by Dunnett's test to compare each mutant to the wild-type control

    • Apply Bonferroni or Tukey's correction for multiple comparisons

  • Survival analysis: For toxicity assays measuring time to growth inhibition, apply Kaplan-Meier survival curves and log-rank tests to compare wild-type and mutant strains.

  • Structure-function correlation: When analyzing multiple mutations:

    • Perform principal component analysis (PCA) to identify patterns in functional effects

    • Use hierarchical clustering to group mutations with similar phenotypic impacts

    • Apply multiple regression to correlate specific physicochemical properties of substituted amino acids with functional outcomes

  • Bootstrapping techniques: For datasets with high variability, bootstrapping provides robust confidence intervals without assuming normal distribution.

The amino acid residues identified as critical for MdtI function (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) should be analyzed in the context of their conservation across species and their predicted roles in the transport mechanism .

How can recombinant Salmonella heidelberg expressing modified MdtI be utilized in vaccine development?

Attenuated Salmonella strains have demonstrated utility as vaccine vectors, particularly in prime-boost vaccination strategies. The application of recombinant S. heidelberg expressing modified MdtI in vaccine development could follow methodologies similar to those used with S. Typhi strain CVD 908-htrA:

  • Attenuation strategy: Develop S. heidelberg strains with attenuating mutations similar to the htrA modification used in S. Typhi, ensuring safety while maintaining immunogenicity .

  • Antigen delivery approach: The mdtI gene could be modified to express fusion proteins containing epitopes from pathogens of interest, similar to the fragment C (Frag C) of tetanus toxin approach .

  • Heterologous prime-boost strategy: Initial mucosal priming with recombinant S. heidelberg followed by parenteral boosting has shown enhanced and accelerated immune responses in mouse models . The vaccination protocol could be structured as:

Vaccination StageRouteCompositionTimeline
PrimeIntranasalAttenuated S. heidelberg expressing MdtI-antigen fusionDay 0
BoostIntramuscularPurified antigen proteinDay 28
  • Immune response assessment: Evaluate both humoral and cellular responses:

    • Serum IgG responses against the target antigen

    • Neutralizing antibody titers

    • T-cell responses (IFN-γ production)

    • Mucosal IgA responses

Studies with S. Typhi demonstrated that heterologous prime-boost regimens elicited higher levels of antigen-specific neutralizing antibodies compared to homologous vaccination approaches, suggesting this strategy could be effective for S. heidelberg vectors as well .

What are the key considerations for using MdtI as a carrier protein in recombinant vaccine design?

When utilizing MdtI as a carrier protein in recombinant vaccine design, researchers should address several critical considerations:

  • Protein topology and insertion sites: As a membrane protein, MdtI has limited exposed regions for antigen fusion. Careful structural analysis is needed to identify optimal insertion sites that:

    • Do not disrupt protein folding

    • Present the antigen to the immune system effectively

    • Maintain sufficient expression levels

  • Stability and expression optimization: Membrane proteins can be challenging to express. Consider:

    • Codon optimization for enhanced expression in Salmonella heidelberg

    • Use of signal sequences to ensure proper membrane targeting

    • Inclusion of stabilizing mutations if necessary

  • Immunogenicity balance: The carrier protein should not dominate the immune response:

    • Evaluate pre-existing immunity to MdtI in target populations

    • Design constructs that focus immune responses on the inserted antigen

    • Consider using only immunogenic fragments of MdtI rather than the full protein

  • Safety considerations: MdtI's role in polyamine export raises safety considerations:

    • Assess whether modified MdtI affects bacterial virulence

    • Ensure attenuated strains remain attenuated despite MdtI modification

    • Evaluate potential off-target effects of altered polyamine homeostasis

  • Delivery system optimization: The prime-boost strategy that proved successful with other Salmonella-based vaccines should be optimized:

    • Test various prime-boost intervals

    • Compare multiple administration routes

    • Evaluate different boosting antigens

Experimental data from related recombinant Salmonella vaccine studies suggest that heterologous prime-boost approaches generate robust, balanced immune responses with both Th1 and Th2 components, which would be advantageous for vaccines employing MdtI as a carrier .

What key knowledge gaps remain in our understanding of MdtI function in Salmonella heidelberg?

Despite advances in characterizing the MdtJI complex, several critical knowledge gaps persist, particularly in the context of Salmonella heidelberg:

  • Species-specific variations: While MdtI has been well-characterized in E. coli, species-specific variations in structure, regulation, and function in S. heidelberg require further investigation .

  • Regulatory networks: The comprehensive transcriptional and post-transcriptional regulatory networks controlling mdtI expression in response to various environmental stressors remain incompletely understood.

  • Structural details: High-resolution structural data for the MdtJI complex, particularly in the context of substrate binding and translocation, would significantly advance our understanding of its mechanism.

  • Alternative substrates: Whether MdtI in S. heidelberg can transport molecules other than spermidine, potentially contributing to antimicrobial resistance, remains an open question.

  • In vivo relevance: The significance of MdtI-mediated spermidine export for S. heidelberg pathogenesis, colonization, and survival within host environments needs further elucidation.

Addressing these knowledge gaps will require integrative approaches combining structural biology, functional genomics, and in vivo infection models.

What hybrid experimental design would best integrate multiple timescales of MdtI regulation?

A hybrid experimental design combining elements of SMART and MRT approaches would be most effective for comprehensively investigating MdtI regulation across multiple timescales:

  • Design structure:

    • Macro-level SMART component: Initial randomization to different growth conditions with adaptive interventions based on bacterial response

    • Micro-level MRT component: Embedded rapid randomization to study immediate regulatory responses

  • Implementation strategy:

    • Phase 1: Initial characterization using reporter systems (mdtI-GFP fusions) to monitor expression

    • Phase 2: SMART framework with adaptation based on expression patterns

    • Phase 3: MRT component with high-frequency environmental perturbations and real-time monitoring

  • Integrated data collection:

    • Continuous fluorescence measurements for real-time expression changes

    • Periodic sampling for transcriptomics and proteomics

    • End-point functional assays of spermidine export activity

  • Analysis approach:

    • Time-series analysis to identify regulatory patterns

    • Causal inference methods to distinguish direct vs. indirect effects

    • Mathematical modeling to integrate data across timescales

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.