Recombinant Salmonella heidelberg Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Spermidine Export

MdtJ forms a heterodimeric complex with MdtI, belonging to the Small Multidrug Resistance (SMR) family of transporters. Key functional insights:

  • Mechanism: Exports excess spermidine to mitigate toxicity, maintaining intracellular polyamine balance .

  • Critical Residues:

    • MdtJ: Tyr⁴, Trp⁵, Glu¹⁵, Tyr⁴⁵, Tyr⁶¹, Glu⁸² .

    • MdtI: Glu⁵, Glu¹⁹, Asp⁶⁰, Trp⁶⁸, Trp⁸¹ .

  • Regulation: Expression is upregulated by spermidine accumulation and bile components in Shigella .

Pathogenicity and Virulence Associations

In Salmonella heidelberg, MdtJ contributes to virulence through:

  • Stress Adaptation: Part of the Cpx regulon, which regulates polyamine homeostasis and heat shock responses under envelope stress .

  • Host Interactions: Enhanced expression of flagellar and fimbriae-related genes in pathogenic S. heidelberg strains correlates with increased epithelial cell invasion (e.g., 12.12% invasion rate in bovine cells vs. 1.73% for less pathogenic variants) .

Genomic and Phenotypic Variants

Comparative studies of S. heidelberg outbreak strains highlight MdtJ’s role in pathogenicity:

StrainPFGE PatternMortality RateGenomic Features
SX 245JF6X01.052325–65%Lacks 204 genes (IncI1 plasmid/phages); upregulated fimbriae/flagella genes .
SX 244JF6X01.0590<10%Retains IncI1 plasmid; lower invasion efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; SeHA_C1651; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ and what is its function in Salmonella heidelberg?

MdtJ is a membrane protein that, together with MdtI, forms the MdtJI complex which functions as a spermidine excretion system. This complex belongs to the small multidrug resistance (SMR) family of drug exporters. In Salmonella species, the MdtJI complex contributes to polyamine homeostasis by exporting excess spermidine from the cell, which is critical for preventing spermidine toxicity. Studies in E. coli have shown that both mdtJ and mdtI genes are necessary for recovery from toxicity caused by spermidine overaccumulation . The presence or absence of functional MdtJ may contribute to differences in pathogenicity between Salmonella heidelberg strains, as variations in genomic content have been observed between high and low pathogenicity variants .

How is the mdtJ gene organized in the Salmonella heidelberg genome?

The mdtJ gene in Salmonella heidelberg is typically found adjacently to mdtI, as these genes encode proteins that function together as a complex. Genomic analysis of Salmonella heidelberg strains has revealed that certain variants may lack specific genes compared to others. For example, in the 2015-2017 multidrug-resistant outbreak associated with dairy beef calves, the high-pathogenicity strain SX 245 lacked approximately 200 genes present in the low-pathogenicity strain SX 244, while SX 244 lacked 8 genes present in SX 245 . Although the specific status of mdtJ was not detailed in the search results, the genomic variations between strains highlight the importance of examining gene presence/absence patterns when studying bacterial virulence factors.

How does spermidine export via MdtJ affect bacterial physiology?

Spermidine export via the MdtJI complex is crucial for maintaining appropriate intracellular polyamine levels. Research has demonstrated that the MdtJI complex catalyzes the excretion of spermidine from cells, which helps prevent toxic accumulation. When bacterial cells are cultured in the presence of high spermidine concentrations (e.g., 2 mM), those expressing functional MdtJI show decreased intracellular spermidine content and enhanced excretion compared to cells lacking this system . This regulation of polyamine homeostasis affects multiple cellular processes, as polyamines like spermidine are involved in DNA stability, cell growth, biofilm formation, and stress responses. The expression of the mdtJI genes is upregulated by increased spermidine levels, suggesting a feedback mechanism to maintain polyamine homeostasis .

What techniques are most effective for studying MdtJ function in Salmonella heidelberg?

Several complementary approaches are effective for studying MdtJ function:

  • Gene deletion and complementation studies: Creating mdtJ knockout mutants in Salmonella heidelberg followed by phenotypic characterization and complementation with the wild-type gene to confirm specificity of observed effects.

  • Spermidine excretion assays: Measuring intracellular and extracellular spermidine levels in wild-type versus mdtJ-deficient strains when cultured in spermidine-supplemented media. This can be done using HPLC or mass spectrometry-based methods.

  • Growth inhibition assays: Comparing growth of wild-type and mdtJ-deficient strains in the presence of high spermidine concentrations to assess the role of MdtJ in polyamine toxicity resistance.

  • Site-directed mutagenesis: Specific residues in MdtJ, including Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82, have been identified as critical for spermidine excretion activity . Mutating these residues can provide insights into structure-function relationships.

  • RNA-sequencing: To analyze global gene expression changes in response to mdtJ deletion or overexpression, similar to the approach used to compare high and low pathogenicity Salmonella heidelberg strains .

How can researchers effectively express and purify recombinant MdtJ for structural and functional studies?

Expressing and purifying membrane proteins like MdtJ presents several challenges. The following protocol is recommended:

  • Gene cloning: Amplify the mdtJ gene from Salmonella heidelberg genomic DNA and clone it into a suitable expression vector with an inducible promoter (e.g., pET or pBAD systems).

  • Expression host selection: Use specialized E. coli strains optimized for membrane protein expression, such as C43(DE3) or Lemo21(DE3).

  • Expression conditions optimization:

    • Temperature: 16-20°C typically yields better results for membrane proteins

    • Inducer concentration: Lower concentrations often improve proper folding

    • Media composition: Consider using defined media with optimized salt concentrations

  • Membrane extraction: Isolate bacterial membranes by ultracentrifugation following cell lysis.

  • Solubilization: Use appropriate detergents (e.g., DDM, LMNG, or DMNG) to solubilize membrane-embedded MdtJ.

  • Purification strategy:

    • Include affinity tags (His, FLAG, etc.) for initial purification

    • Follow with size exclusion chromatography to ensure homogeneity

    • Consider purifying the MdtJ-MdtI complex rather than individual proteins for functional studies

Purification StepRecommended ConditionsCommon IssuesTroubleshooting
Membrane isolation100,000×g, 1h, 4°CIncomplete separationIncrease centrifugation time
Solubilization1% DDM, 4°C, overnightPoor solubilizationTry alternative detergents
Affinity purificationIMAC with imidazole gradientNon-specific bindingInclude low imidazole in wash buffer
Size exclusionSuperdex 200, detergent above CMCAggregationAdjust detergent or add stabilizers

What are the most reliable methods to assess spermidine export activity mediated by MdtJ?

To reliably assess MdtJ-mediated spermidine export activity, researchers can employ several complementary approaches:

  • Cellular spermidine content analysis:

    • Culture bacteria (wild-type and mdtJ mutants) in media with defined spermidine concentrations

    • Extract intracellular polyamines using acid extraction protocols

    • Quantify spermidine using HPLC with pre-column derivatization (e.g., dansylation) or LC-MS/MS

  • Direct transport assays:

    • Use radiolabeled spermidine ([3H]-spermidine) to measure uptake and efflux kinetics

    • Compare efflux rates between strains expressing wild-type MdtJ versus mutant variants

    • Include competitive inhibitors to confirm specificity

  • Toxicity resistance assays:

    • Determine the minimum inhibitory concentration of spermidine in wild-type versus mdtJ-deficient strains

    • Perform growth curve analysis in the presence of various spermidine concentrations

    • Assess recovery after spermidine exposure

  • Gene expression analysis:

    • Monitor mdtJI expression using qRT-PCR or reporter gene fusions in response to varying spermidine levels

    • This approach provides indirect evidence of system activation

The most robust experimental design would incorporate multiple of these methods and include appropriate controls, such as comparing function of known MdtJ variants with mutations in key residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) .

How does MdtJ contribute to Salmonella heidelberg pathogenicity?

The contribution of MdtJ to Salmonella heidelberg pathogenicity remains an area requiring further research, but several hypotheses can be formulated based on available data:

  • Polyamine homeostasis during infection: By mediating spermidine export, MdtJ may help Salmonella heidelberg maintain optimal intracellular polyamine levels during infection, which is critical for bacterial survival under stress conditions encountered within the host.

  • Strain-specific virulence differences: The comparison of high (SX 245) and low (SX 244) pathogenicity Salmonella heidelberg strains from the 2015-2017 outbreak revealed that SX 245 had higher invasion rates in both human and bovine epithelial cells . Although MdtJ was not specifically mentioned in this context, differences in gene content between strains included factors affecting virulence.

  • Potential role in stress resistance: Polyamines contribute to bacterial resistance against various stresses, including oxidative stress encountered within macrophages. MdtJ-mediated spermidine export might influence this aspect of pathogen-host interaction.

To definitively establish the role of MdtJ in pathogenicity, comparative infection studies using isogenic mdtJ mutants and wild-type strains in relevant cell culture and animal models would be necessary.

What is the relationship between MdtJ expression and host invasion by Salmonella heidelberg?

  • Invasion of human epithelial cells (HEp-2): SX 245 showed a >2-fold higher invasion rate (1.35%) compared to SX 244 (0.58%) .

  • Invasion of bovine epithelial cells (MDBK): The difference was even more pronounced in bovine cells, with SX 245 showing a >7-fold higher invasion rate (12.12%) compared to SX 244 (1.73%) .

These differences were attributed to differential expression of virulence-associated genes, including those involved in fimbriae production, flagellar regulation and biogenesis, and chemotaxis . While MdtJ was not specifically mentioned among these factors, its potential contribution to invasion capacity through polyamine homeostasis regulation merits investigation.

How does MdtJ function compare between different pathogenic Salmonella serovars?

Comparative analysis of MdtJ function across different Salmonella serovars would provide valuable insights into serovar-specific adaptations. While the search results don't directly address this comparison, we can outline a research approach:

  • Sequence analysis: Compare mdtJ sequences across Salmonella serovars to identify conserved and variable regions, particularly focusing on residues known to be critical for function (e.g., Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82) .

  • Functional complementation: Test whether MdtJ from one serovar can complement mdtJ deletion in another serovar, providing insights into functional conservation.

  • Expression patterns: Compare mdtJ expression levels and regulation across serovars under standardized conditions and during infection.

  • Host adaptation correlation: Determine if variations in MdtJ sequence or expression correlate with host adaptation patterns of different serovars (e.g., host-restricted versus broad-host-range serovars).

This comparative approach could reveal whether MdtJ has evolved serovar-specific functions that contribute to the distinct ecological niches and pathogenic profiles of different Salmonella serovars.

Which amino acid residues are critical for MdtJ function, and how can this inform structure-based studies?

Research has identified several critical amino acid residues in MdtJ that are essential for the spermidine excretion function of the MdtJI complex. In E. coli MdtJ, the following residues have been demonstrated to be involved in spermidine export activity:

  • Tyr4

  • Trp5

  • Glu15

  • Tyr45

  • Tyr61

  • Glu82

Similarly, critical residues in the partner protein MdtI include:

  • Glu5

  • Glu19

  • Asp60

  • Trp68

  • Trp81

These findings provide valuable starting points for structure-based studies of the MdtJI complex in Salmonella heidelberg. The prevalence of acidic residues (Glu) suggests their importance in interactions with the positively charged spermidine substrate. The aromatic residues (Tyr, Trp) likely play roles in substrate recognition through cation-π interactions or in maintaining proper protein conformation.

Structure-based studies could focus on:

  • Creating homology models of the Salmonella heidelberg MdtJI complex

  • Performing molecular docking simulations with spermidine

  • Using site-directed mutagenesis to validate the roles of these conserved residues in Salmonella heidelberg MdtJ

How does the MdtJI complex assemble, and what techniques are best for studying this protein complex?

The assembly of the MdtJI complex involves interactions between the membrane proteins MdtJ and MdtI. While the exact stoichiometry and structural organization of this complex in Salmonella heidelberg have not been detailed in the search results, several techniques can be employed to study this protein complex:

  • Biochemical approaches:

    • Co-immunoprecipitation to confirm protein-protein interactions

    • Cross-linking studies to capture the native complex

    • Blue native PAGE to analyze the oligomeric state

  • Biophysical methods:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine complex size

    • Analytical ultracentrifugation for stoichiometry determination

    • Förster resonance energy transfer (FRET) using fluorescently labeled proteins to study complex formation dynamics

  • Structural biology techniques:

    • Cryo-electron microscopy for structure determination of the intact complex

    • X-ray crystallography (challenging but potentially high-resolution)

    • NMR spectroscopy for specific domains or interfaces

  • Computational approaches:

    • Molecular dynamics simulations to study complex stability

    • Protein-protein docking to predict interaction interfaces

    • Coevolution analysis to identify residue pairs likely to be in contact

Understanding the assembly of the MdtJI complex is crucial for interpreting its functional mechanism and could provide insights into potential targets for inhibition.

What is the mechanism of spermidine transport by the MdtJI complex?

The detailed mechanism of spermidine transport by the MdtJI complex has not been fully elucidated, but based on the available information, several aspects of this process can be described:

  • Substrate recognition: Specific residues in both MdtJ (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82) and MdtI (Glu5, Glu19, Asp60, Trp68, Trp81) are involved in the spermidine export activity . The presence of multiple acidic residues (Glu, Asp) suggests their importance in interacting with the positively charged spermidine molecule.

  • Complex formation: Both MdtJ and MdtI are necessary for spermidine export function, indicating that they form a functional complex rather than operating independently .

  • Transport directionality: The MdtJI complex functions as an exporter, reducing intracellular spermidine levels when cells are exposed to high external spermidine concentrations .

  • Regulation: The expression of mdtJI is increased by spermidine, suggesting a regulatory feedback mechanism that enhances export capacity when spermidine levels rise .

The transport likely involves conformational changes in the MdtJI complex that allow spermidine binding on the cytoplasmic side, followed by reorientation of the binding site to the periplasmic side and release of the substrate. Further structural and functional studies are needed to elucidate the detailed steps of this process.

How can genetically modified MdtJ be utilized for studying Salmonella heidelberg pathogenesis?

Genetically modified MdtJ can be a valuable tool for investigating Salmonella heidelberg pathogenesis through several approaches:

  • Reporter fusions: Creating MdtJ-reporter protein fusions (e.g., with fluorescent proteins) can allow real-time monitoring of MdtJ expression and localization during infection, providing insights into when and where this system is activated.

  • Controlled expression systems: Developing strains with inducible mdtJ expression can help determine dose-dependent effects of MdtJ activity on virulence-related phenotypes.

  • Domain swap experiments: Exchanging domains between MdtJ proteins from different Salmonella serovars or strains with varying pathogenicity (e.g., SX 245 vs. SX 244) can help identify regions responsible for strain-specific differences in function.

  • Tagged variants for interaction studies: Creating affinity-tagged MdtJ variants enables identification of potential interaction partners beyond MdtI that might contribute to pathogenesis.

  • Conditional knockout systems: Implementing systems for tissue-specific or time-dependent inactivation of mdtJ can reveal its importance at different stages of infection.

These approaches could help establish connections between MdtJ function and the observed differences in pathogenicity between Salmonella heidelberg strains, such as the higher invasion rates of human and bovine epithelial cells by strain SX 245 compared to SX 244 .

What is the potential for targeting MdtJ as an antimicrobial strategy?

The potential for targeting MdtJ as an antimicrobial strategy stems from its role in polyamine homeostasis, which is crucial for bacterial survival. Several approaches could be considered:

  • Direct inhibition: Developing small molecule inhibitors that specifically target the MdtJI complex could disrupt spermidine export, potentially leading to toxic accumulation of polyamines within bacterial cells.

  • Structure-based drug design: Using the identified critical residues in MdtJ (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82) as targets for rational drug design could yield highly specific inhibitors.

  • Adjuvant therapy: MdtJI inhibitors might increase bacterial sensitivity to existing antibiotics by disrupting homeostatic mechanisms that contribute to stress resistance.

  • Anti-virulence approach: If MdtJ contributes to virulence but is not essential for growth under all conditions, inhibitors could reduce pathogenicity without imposing strong selective pressure for resistance development.

  • The membrane-embedded nature of MdtJ complicates drug delivery

  • Potential off-target effects on host polyamine transporters

  • The existence of redundant polyamine homeostasis mechanisms

Research into the specific contribution of MdtJ to Salmonella heidelberg pathogenicity is needed before its potential as an antimicrobial target can be fully assessed.

How do environmental factors influence mdtJ expression in Salmonella heidelberg, and what are the implications for host-pathogen interactions?

Understanding how environmental factors influence mdtJ expression in Salmonella heidelberg is crucial for comprehending host-pathogen interactions. While specific information about mdtJ regulation in Salmonella heidelberg is limited in the search results, several research directions can be proposed:

  • Host-relevant conditions: Investigate mdtJ expression under conditions mimicking different host environments:

    • Acidic pH (stomach, phagosome)

    • Limited oxygen (intestinal lumen)

    • Presence of bile salts

    • Varying nutrient availability

    • Exposure to host antimicrobial peptides

  • Polyamine sensing: The observation that mdtJI mRNA levels increase in response to spermidine suggests a regulatory mechanism sensitive to polyamine levels. This should be characterized in detail, including identification of the transcription factors involved.

  • Stress responses: Determine if mdtJ expression changes in response to stresses encountered during infection:

    • Oxidative and nitrosative stress

    • Heat shock

    • Envelope stress

    • Nutrient limitation

  • Host cell contact: Examine whether contact with host cells triggers changes in mdtJ expression, particularly in the context of invasion of epithelial cells where significant differences were observed between high and low pathogenicity strains .

Understanding these regulatory mechanisms could provide insights into how Salmonella heidelberg adapts to different host environments and might explain differences in virulence between strains like SX 245 and SX 244 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.