Recombinant Salmonella heidelberg Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
arnC; SeHA_C2538; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
arnC
Target Protein Sequence
MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxin and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Salmonella heidelberg?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is subsequently attached to lipid A, a critical component of the bacterial outer membrane lipopolysaccharide (LPS). The resulting modification is essential for resistance to polymyxins and other cationic antimicrobial peptides . In Salmonella heidelberg, this enzyme is part of the arnBCDTEF operon which, together with pmrE(ugd) loci, contributes to antimicrobial peptide resistance by altering the charge characteristics of the bacterial outer membrane .

What are the structural characteristics of ArnC protein?

Recent cryo-EM structural studies of ArnC from Salmonella typhimurium have revealed that each ArnC protomer comprises three distinct regions:

  • An N-terminal glycosyltransferase domain

  • A transmembrane region

  • Interface helices (IHs)

The protein forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, which protrudes into the cytosol. The β8 strand of each protomer inserts into the adjacent protomer, stabilizing the quaternary structure. The protomers exhibit two distinct types of interfaces involving multiple hydrogen bonds and salt bridges .

When UDP binds to ArnC, it induces conformational changes that stabilize the structurally labile A-loop (residues 201-213) and part of the putative catalytic pocket formed by interface helices IH1 and IH2 . ArnC is classified as a type-2 glycosyltransferase (GT-2) based on sequence similarity analyses.

What are the optimal conditions for expressing recombinant Salmonella heidelberg ArnC in E. coli expression systems?

When expressing recombinant Salmonella heidelberg ArnC in E. coli expression systems, researchers should consider several critical parameters:

ParameterRecommended ConditionsConsiderations
Expression vectorpET series with T7 promoterStrong inducible promoter suitable for membrane proteins
Host strainC41(DE3) or C43(DE3)Specialized for membrane protein expression
Growth temperature18-22°C post-inductionLower temperature reduces inclusion body formation
Induction0.1-0.5 mM IPTGLower IPTG concentrations favor properly folded protein
Media supplements0.2-0.5% glucoseReduces basal expression before induction
Membrane extraction1-2% n-dodecyl-β-D-maltoside (DDM)Efficient for solubilizing membrane proteins while maintaining structure

This expression protocol incorporates considerations specific to membrane-bound glycosyltransferases like ArnC. Since ArnC contains transmembrane regions, standard approaches used for soluble proteins may yield poor results . Monitoring expression through Western blotting with anti-His tag antibodies (assuming a His-tag is incorporated) is recommended to optimize conditions for your specific construct.

How should researchers design experiments to assess the enzymatic activity of recombinant Salmonella heidelberg ArnC?

To assess ArnC enzymatic activity, researchers should implement a multi-faceted approach:

  • In vitro activity assay: Design an assay system containing:

    • Purified recombinant ArnC (in appropriate detergent micelles)

    • UDP-4-deoxy-4-formamido-L-arabinose substrate

    • Undecaprenyl phosphate acceptor (incorporated into liposomes)

    • Divalent cations (typically Mg²⁺ or Mn²⁺)

    • Appropriate buffer system (pH 7.0-7.5)

  • Product detection methods:

    • Radiolabeled substrate approach: Use ¹⁴C-labeled UDP-4-deoxy-4-formamido-L-arabinose to track product formation

    • LC-MS/MS analysis: For precise quantification of UndP-Ara4FN formation

    • Coupled enzyme assays: Measure UDP release using commercial UDP detection kits

  • Kinetic analysis:

    • Determine Km values for both substrates

    • Assess Vmax and catalytic efficiency

    • Examine the effects of potential inhibitors

  • Controls:

    • Include heat-inactivated enzyme as a negative control

    • Use site-directed mutants of predicted catalytic residues based on structural information

    • Compare wildtype activity with that of variants identified in different Salmonella heidelberg strains

This methodological approach aligns with techniques used for characterizing other glycosyltransferases involved in bacterial cell envelope modification and will provide robust data on ArnC function.

What methodologies are most effective for studying the interaction between ArnC and other proteins in the arn operon?

The interaction between ArnC and other proteins in the arn operon can be effectively studied using complementary approaches:

  • Bacterial two-hybrid system:

    • Particularly useful for membrane protein interactions

    • Can detect interactions in a cellular environment

    • Maintains proteins in their native membrane environment

  • Co-immunoprecipitation with crosslinking:

    • Use membrane-permeable crosslinkers like DSP (dithiobis(succinimidyl propionate))

    • Extract complexes using mild detergents

    • Identify interacting partners through western blotting or mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Tag ArnC and potential partners with appropriate fluorophores

    • Enables the study of interactions in living cells

    • Can provide spatial information about protein proximity

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments fused to potential interacting partners

    • Fluorescence occurs only when proteins interact

    • Allows visualization of interaction sites within cells

  • Proximity-dependent biotin identification (BioID):

    • Fuse ArnC to a biotin ligase

    • Proteins in close proximity become biotinylated

    • Identify biotinylated proteins by streptavidin pulldown and mass spectrometry

These methods should be applied with consideration of the membrane-associated nature of ArnC and other Arn proteins. Since ArnC forms a tetramer , these techniques can also help elucidate whether interactions with other Arn proteins occur within the context of this quaternary structure or involve the assembled tetramer as a functional unit.

How do structural differences in ArnC between different Salmonella heidelberg strains correlate with virulence and antibiotic resistance profiles?

The correlation between ArnC structural variations and phenotypic differences in Salmonella heidelberg strains represents a sophisticated research question that requires integration of genomic, structural, and functional analyses:

  • Comparative sequence analysis:

    • Perform whole-genome sequencing of multiple Salmonella heidelberg isolates with varying virulence profiles

    • Identify single nucleotide polymorphisms (SNPs) or other variations in the arnC gene

    • Map these variations onto the known structural model of ArnC

    • Determine if variations occur in catalytic domains, oligomerization interfaces, or substrate binding regions

  • Structure-function correlation:

    • Express recombinant variants of ArnC containing identified mutations

    • Assess enzymatic activity using methods described in section 2.2

    • Determine whether structural variations alter tetramer formation or stability

    • Evaluate catalytic efficiency and substrate specificity of different variants

  • Phenotypic analysis:

    • Construct isogenic strains differing only in arnC variants

    • Assess minimum inhibitory concentrations (MICs) of polymyxins and other antimicrobials

    • Evaluate virulence in cell culture invasion assays

    • Compare lipid A modification profiles by mass spectrometry

Recent research has shown that different Salmonella heidelberg strains can exhibit distinct virulence characteristics. For example, strain SX 245 (PFGE pattern JF6X01.0523) was identified as highly pathogenic with high morbidity and mortality in calves, while strain SX 244 (PFGE pattern JF6X01.0590) caused less severe disease . Although these differences were primarily attributed to variations in fimbriae-related, flagella-related, and chemotaxis genes, the contribution of arnC variations to these phenotypes has not been fully explored and represents an important research direction.

What methodological approaches can resolve contradictory data on the contribution of ArnC to host-specific pathogenicity of Salmonella heidelberg?

When faced with contradictory data regarding ArnC's role in host-specific pathogenicity, researchers should implement a systematic approach to resolve discrepancies:

  • Meta-analysis of existing data:

    • Systematically review published literature for methodological differences

    • Identify potential confounding variables across studies

    • Analyze strain backgrounds used in different studies

  • Standardized genetic approaches:

    • Create clean deletion mutants using lambda Red recombinase system

    • Construct complemented strains using single-copy chromosomal integration

    • Develop regulated expression systems to titrate ArnC levels

    • Compare results across multiple reference strains

  • Host-specific models:

    • Employ bovine, avian, and human cell culture models in parallel

    • Assess invasion, intracellular survival, and host response

    • Use primary cells when possible rather than immortalized cell lines

    • Compare results with in vivo infection models

  • Multi-omics integration:

    • Combine transcriptomics of both pathogen and host

    • Profile lipid A modifications using lipidomics

    • Assess global protein interaction networks

    • Integrate data using systems biology approaches

  • Environmental variable control:

    • Systematically test effects of growth conditions on arnC expression

    • Assess impact of pH, magnesium concentration, and other PhoP/Q and PmrA/B activators

    • Evaluate temperature effects relevant to different host species

This methodological framework acknowledges that contradictory findings may stem from subtle differences in experimental design, genetic background effects, or environmental variables that influence the complex regulatory networks controlling arnC expression and function.

How can cryo-EM structural data on ArnC be leveraged to design specific inhibitors as potential adjuvants to restore polymyxin sensitivity?

The recent cryo-EM structures of ArnC provide an excellent foundation for structure-based inhibitor design:

  • Computational approaches:

    • Perform molecular dynamics simulations of ArnC in membrane environments

    • Identify binding pocket characteristics and key residues

    • Conduct virtual screening of compound libraries against the UDP-binding site

    • Implement fragment-based in silico screening approaches

    • Use pharmacophore modeling based on substrate interaction patterns

  • Structure-guided design:

    • Focus on the catalytic pocket formed by interface helices IH1 and IH2

    • Target the UDP-binding site identified in the cryo-EM structure

    • Design transition state analogs based on the glycosyl transfer reaction

    • Consider compounds that may disrupt tetramer formation through β8 strand displacement

  • Experimental validation pipeline:

    • Develop high-throughput screening assays based on:

      • Fluorescence-based UDP detection

      • Surface plasmon resonance for binding analysis

      • Thermal shift assays for protein stabilization

    • Test top candidates in enzymatic assays

    • Evaluate membrane permeability of promising compounds

    • Assess synergy with polymyxins in antimicrobial susceptibility testing

  • Lead optimization strategy:

    • Use structure-activity relationship studies to improve potency

    • Optimize physicochemical properties for bacterial penetration

    • Balance specificity to minimize effects on host glycosyltransferases

    • Consider pro-drug approaches for improved delivery

The comparative analysis of ArnC structures with homologs GtrB and DPMS provides additional insights into conserved and unique features that can be exploited for selective inhibitor design. Since ArnC functions at the inner membrane, inhibitor design must account for penetration through the outer membrane of Gram-negative bacteria, possibly through siderophore conjugation or other delivery strategies.

What are the key challenges in purifying functional recombinant Salmonella heidelberg ArnC, and how can they be addressed?

Purifying functional recombinant ArnC presents several challenges due to its membrane-associated nature and complex quaternary structure:

ChallengeTechnical SolutionMethodological Considerations
Low expression yieldsUse specialized expression strains (C41/C43)These strains contain mutations that prevent toxic effects of membrane protein overexpression
Protein aggregationExpression at low temperatures (16-20°C)Slower expression allows proper membrane insertion
Maintaining tetramer integrityOptimize detergent selectionTest DDM, LMNG, GDN, and digitonin for tetramer preservation
Heterogeneous glycosylationExpress in glycosylation-deficient strainsReduces sample heterogeneity for structural studies
Poor stability during purificationInclude lipids during purificationE. coli polar lipid extract at 0.1-0.2 mg/mL stabilizes membrane proteins
Loss of activityReconstitute in nanodiscs or liposomesProvides native-like membrane environment for functional studies
Tetramer dissociationUse mild crosslinking agentsGlutaraldehyde or BS3 can stabilize quaternary structure

For optimal results, implement a purification strategy that includes:

  • Gentle solubilization of membranes (1% DDM, 4°C, 1 hour)

  • Immobilized metal affinity chromatography with gradient elution

  • Size exclusion chromatography to isolate tetrameric fraction

  • Optional reconstitution into nanodiscs using MSP1D1 scaffold protein

This approach has been successfully employed for structural studies of ArnC from Salmonella typhimurium and can be adapted for Salmonella heidelberg ArnC.

How can researchers effectively analyze differences in arnC gene expression between Salmonella heidelberg strains with varying virulence profiles?

To effectively analyze arnC expression differences between Salmonella heidelberg strains:

  • RNA-sequencing approach:

    • Conduct RNA-seq under standardized conditions for multiple strains

    • Include conditions that mimic host environments (low Mg²⁺, acidic pH)

    • Perform differential expression analysis using DESeq2 or similar tools

    • Look for co-expressed genes to identify regulatory networks

  • Quantitative RT-PCR validation:

    • Design primers specific to conserved regions of arnC

    • Use multiple reference genes for normalization

    • Validate expression differences under various growth conditions

    • Include time-course analyses to capture temporal regulation

  • Reporter fusion systems:

    • Construct transcriptional and translational fusions with fluorescent proteins

    • Introduce these constructs into different Salmonella heidelberg strains

    • Monitor expression in real-time using microplate fluorometry

    • Use flow cytometry to assess population heterogeneity

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors that bind the arnC promoter

    • Compare binding patterns between different strains

    • Associate regulatory differences with expression patterns

Research has shown significant differences in gene expression between Salmonella heidelberg strains with varying virulence. For example, the highly pathogenic strain SX 245 exhibited increased expression of fimbriae-related, flagella-related, and chemotaxis genes compared to the less virulent strain SX 244 . Similar approaches can be applied to analyze arnC expression in the context of these differing virulence profiles.

What experimental design considerations are crucial when investigating the relationship between ArnC activity and polymyxin resistance in clinical isolates?

When investigating ArnC activity and polymyxin resistance in clinical isolates, consider these experimental design elements:

  • Isolate characterization:

    • Sequence the complete arn operon and regulatory genes (pmrAB, phoPQ)

    • Determine MICs for multiple polymyxins (polymyxin B, colistin)

    • Assess cross-resistance to other cationic antimicrobial peptides

    • Document patient history, including previous antimicrobial therapy

  • Lipid A analysis:

    • Implement MALDI-TOF mass spectrometry to quantify Ara4N-modified lipid A

    • Compare lipid A profiles before and after polymyxin exposure

    • Correlate modification levels with arnC sequence variants and expression

    • Assess heterogeneity in lipid A modification within populations

  • Genetic manipulation strategy:

    • Create isogenic mutants with arnC deletions in clinical isolate backgrounds

    • Complement with various arnC alleles from different strains

    • Use inducible expression systems to titrate ArnC levels

    • Assess impact of regulatory mutations on arnC expression

  • Comprehensive phenotypic testing:

    • Time-kill assays with polymyxins at various concentrations

    • Population analysis profiles to detect heteroresistant subpopulations

    • Competition assays to assess fitness costs of resistance

    • Host cell interaction studies to link resistance with virulence

  • Controls and reference strains:

    • Include well-characterized laboratory strains as benchmarks

    • Use isolates with known polymyxin resistance mechanisms for comparison

    • Include technical and biological replicates to ensure reproducibility

    • Blind sample analysis when possible to prevent bias

This comprehensive approach acknowledges the complex interplay between genetic variation, gene expression, enzymatic activity, and resistance phenotypes. Since the arnBCDTEF operon operates as a functional unit, the experimental design must consider the entire pathway while focusing on the specific contribution of ArnC.

How might emerging structural biology techniques advance our understanding of ArnC function in Salmonella heidelberg?

Emerging structural biology techniques offer promising avenues for deeper insights into ArnC function:

  • Cryo-electron tomography (cryo-ET):

    • Visualize ArnC in its native membrane environment

    • Study spatial relationships with other Arn proteins

    • Examine potential supramolecular assemblies in intact bacterial cells

    • Resolve structural heterogeneity that may be averaged out in single-particle cryo-EM

  • Time-resolved crystallography/cryo-EM:

    • Capture intermediates in the catalytic cycle

    • Visualize conformational changes during substrate binding and product release

    • Develop microfluidic mixing devices for capturing transient states

    • Implement temperature-jump methods to synchronize enzyme activity

  • Integrative structural biology approaches:

    • Combine cryo-EM with mass spectrometry

    • Implement hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Use cross-linking mass spectrometry (XL-MS) to validate protein interactions

    • Integrate computational modeling with experimental restraints

  • In-cell structural studies:

    • Develop methods for visualizing ArnC structure and conformations in living cells

    • Implement genetic code expansion for site-specific probe incorporation

    • Utilize correlative light and electron microscopy (CLEM)

    • Apply single-molecule Förster resonance energy transfer (smFRET)

The recent cryo-EM structures of ArnC from Salmonella typhimurium in both apo and UDP-bound forms provide a foundation for these advanced approaches, which can reveal dynamic aspects of ArnC function not captured in static structures.

What novel experimental approaches could elucidate the potential relationship between ArnC activity and Salmonella heidelberg host adaptation?

To investigate ArnC's role in host adaptation, researchers should consider these innovative approaches:

  • Organ-on-chip technology:

    • Develop multi-cellular microfluidic systems mimicking host microenvironments

    • Compare bacterial behavior in human, bovine, and avian intestinal models

    • Assess ArnC expression and activity under dynamic flow conditions

    • Evaluate the impact of host-specific factors on ArnC function

  • Single-cell analyses:

    • Implement bacterial cytometry to isolate subpopulations

    • Use single-cell RNA-seq to identify expression heterogeneity

    • Develop fluorescent reporters to monitor arnC expression at the single-cell level

    • Correlate expression with bacterial cell fate during infection

  • Host-microbe interactome mapping:

    • Identify host factors that influence arnC expression

    • Examine impact of host antimicrobial peptides on ArnC activity

    • Use CRISPR screens to identify host factors affecting Salmonella survival

    • Develop bacterial sensors to monitor host microenvironment conditions

  • Comparative genomics and experimental evolution:

    • Compare arnC sequences across Salmonella isolates from different hosts

    • Conduct experimental evolution under host-specific selective pressures

    • Track arnC mutations that arise during host adaptation

    • Develop predictive models of arnC evolution in different host species

The discovery that Salmonella heidelberg strains can differ significantly in virulence between hosts, as seen in the bovine-associated outbreak strains SX 244 and SX 245 , provides an excellent foundation for this research direction. Understanding how ArnC contributes to these host-specific adaptations could reveal fundamental principles of bacterial pathogenesis and host range determination.

How could systems biology approaches integrate ArnC function into broader understanding of Salmonella heidelberg pathogenesis and antimicrobial resistance?

Systems biology approaches offer powerful frameworks for contextualizing ArnC function:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Construct genome-scale metabolic models incorporating lipid A modifications

    • Develop dynamic models of regulatory networks controlling arnC expression

    • Implement flux balance analysis to predict metabolic consequences of ArnC activity

  • Network analysis:

    • Construct protein-protein interaction networks centered on ArnC

    • Identify hub proteins connecting ArnC to virulence and resistance mechanisms

    • Apply graph theory to identify critical nodes in resistance networks

    • Develop predictive models of system responses to perturbations

  • Machine learning applications:

    • Train models to predict ArnC activity based on genomic signatures

    • Develop algorithms to identify critical residues from sequence-function relationships

    • Apply deep learning to predict resistance phenotypes from genomic data

    • Implement reinforcement learning for optimizing experimental design

  • Integrative modeling approaches:

    • Develop multi-scale models linking molecular mechanisms to cellular phenotypes

    • Construct agent-based models of host-pathogen interactions

    • Implement ordinary differential equation (ODE) models of regulatory systems

    • Integrate stochastic modeling to account for cell-to-cell variability

Recent research has shown that increased expression of fimbriae-related, flagella-related, and chemotaxis genes in Salmonella heidelberg strain SX 245 correlates with enhanced virulence . Systems biology approaches can place ArnC function within this broader context, potentially revealing unexpected connections between lipid A modification pathways and other virulence mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.