Recombinant Salmonella heidelberg UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
yfbV; SeHA_C2576; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPVAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQEAGQAL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Which expression systems are most effective for producing recombinant YfbV protein?

Recombinant YfbV can be expressed in multiple host systems, each with distinct advantages. E. coli expression systems provide the highest yields and shortest turnaround times, making them suitable for initial characterization studies . The protein has been successfully expressed in E. coli with an N-terminal His tag .

For studies requiring post-translational modifications or proper protein folding, expression in yeast, insect cells with baculovirus, or mammalian cells may be more appropriate . The choice depends on:

  • Required protein yield

  • Need for post-translational modifications

  • Time constraints

  • Experimental purpose (structural studies vs. functional assays)

For membrane proteins like YfbV, optimization of expression conditions is critical as they often form inclusion bodies when overexpressed in E. coli.

What are the optimal storage conditions for maintaining YfbV protein stability?

The recombinant YfbV protein is typically supplied as a lyophilized powder and requires specific storage conditions to maintain stability and activity . The recommended storage protocol includes:

  • Short-term storage (up to one week): 4°C for working aliquots

  • Long-term storage: -20°C or -80°C

  • Storage buffer: Tris-based buffer with 6% Trehalose, pH 8.0 for lyophilized protein; Tris-based buffer with 50% glycerol for liquid formulations

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity. When reconstituting the lyophilized protein, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for aliquots intended for long-term storage

How can expression of soluble YfbV be optimized using multivariant analysis?

Optimizing the expression of membrane proteins like YfbV in their soluble form requires a systematic approach. Multivariant statistical experimental design offers advantages over traditional univariant methods by:

  • Evaluating multiple variables simultaneously

  • Identifying statistically significant variables and their interactions

  • Characterizing experimental error

  • Requiring fewer experiments to gather high-quality data

A fractional factorial design can be implemented to optimize key variables including:

VariableRange to Test
Temperature16-37°C
Induction time2-24 hours
IPTG concentration0.1-1.0 mM
Media compositionLB, TB, 2XYT
AdditivesGlycerol, sorbitol, arginine

For membrane proteins like YfbV, inclusion of detergents during lysis and purification is critical. Consider testing:

  • Non-ionic detergents (Triton X-100, DDM)

  • Zwitterionic detergents (CHAPS, Fos-choline)

  • Mild ionic detergents (sodium cholate)

The optimization process should measure both total protein yield and soluble fraction percentage to identify conditions that maximize soluble expression rather than inclusion body formation .

What is the relationship between YfbV and Salmonella Heidelberg virulence mechanisms?

While the specific role of YfbV in Salmonella Heidelberg virulence has not been directly characterized in the provided sources, the genomic context provides important insights. Salmonella Heidelberg isolates possess numerous virulence factors, including:

  • Invasion genes (invA) - present in 100% of studied strains

  • Membrane proteins (ompC) - present in 100% of studied strains

  • Fimbrial adhesins (agfA, lpfA) - essential for attachment and biofilm formation

  • Superoxide dismutase (sodC) - providing protection against oxidative stress

The conservation of these virulence genes across Salmonella Heidelberg isolates suggests a coordinated virulence mechanism. As a membrane protein, YfbV may interact with these virulence systems, potentially in:

  • Membrane integrity maintenance

  • Signal transduction

  • Transport functions

  • Biofilm formation support

Interestingly, genomic studies have revealed significant differences in gene content between isolates from different poultry production environments. Turkey farm isolates show enrichment in prophage proteins compared to chicken farm isolates, while genes associated with type IV secretion systems and conjugative transfer were absent in turkey farm isolates . These differences highlight the genomic plasticity of Salmonella Heidelberg and may influence YfbV expression or function in different environmental contexts.

How can structural studies of YfbV inform functional hypotheses?

As a membrane protein with uncharacterized function (UPF0208 family), structural studies of YfbV are essential for generating functional hypotheses. Approaches include:

  • Bioinformatic prediction: Using tools like TMHMM to predict transmembrane domains and protein topology

  • Crystallization trials: Membrane proteins require specialized crystallization techniques:

    • Detergent screening (non-ionic, zwitterionic)

    • Lipidic cubic phase methods

    • Addition of stabilizing antibody fragments

  • Cryo-electron microscopy: Particularly useful for membrane proteins resistant to crystallization

  • NMR studies: For dynamic regions or smaller membrane proteins

  • Computational modeling: Homology modeling based on structurally characterized membrane proteins

Structural data should be correlated with genomic context, considering YfbV's conservation within Salmonella Heidelberg strains and potential interactions with known virulence factors. The membrane localization suggests possible roles in:

  • Transport (nutrient acquisition or toxin export)

  • Sensing (environmental signal detection)

  • Structural support (membrane integrity)

  • Host interaction (adhesion or invasion)

What purification strategy is most effective for recombinant YfbV protein?

Purifying membrane proteins like YfbV requires specialized approaches due to their hydrophobic nature. An effective purification strategy includes:

  • Cell lysis optimization:

    • Mechanical disruption (sonication, high-pressure homogenization)

    • Enzymatic lysis with lysozyme

    • Addition of appropriate detergents to solubilize membrane proteins

  • Initial capture using affinity chromatography:

    • Ni-NTA affinity chromatography leveraging the N-terminal His tag

    • Binding buffer containing detergent at CMC + 0.05%

    • Thorough washing to remove non-specifically bound proteins

    • Imidazole gradient elution (50-500 mM)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography if additional purity is required

  • Quality assessment:

    • SDS-PAGE (>90% purity expected)

    • Western blot confirmation

    • Mass spectrometry validation

Throughout the purification process, maintaining the protein in a detergent-containing buffer is critical to prevent aggregation. For functional studies, consider detergent exchange or reconstitution into lipid nanodiscs or liposomes to better mimic the native membrane environment.

What approaches can be used to study YfbV's role in biofilm formation?

Given that Salmonella Heidelberg is known to form biofilms effectively at different temperatures, studying YfbV's potential role in this process requires multiple experimental approaches:

  • Gene knockout/knockdown studies:

    • Construction of yfbV deletion mutants

    • Complementation with wild-type yfbV gene

    • Phenotypic characterization of biofilm formation ability

  • Biofilm formation assays:

    • Crystal violet staining for quantification

    • Testing at different temperatures (25°C and 37°C)

    • Inclusion of chicken juice (CJ) to mimic production environment conditions

    • Confocal microscopy to assess biofilm architecture

  • Resistance to disinfectants:

    • Exposure to sodium hypochlorite (1%) and other common disinfectants

    • Quantification of sessile cell survival

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with known biofilm-associated proteins

    • Bacterial two-hybrid screening

    • Mass spectrometry-based interactome analysis

Research has shown that Salmonella Heidelberg biofilms reach mature stages at both 25°C and 37°C, particularly with chicken juice addition, and display resistance to disinfectants . Investigating YfbV's specific contribution to these properties would provide valuable insights into Salmonella Heidelberg persistence in production environments.

How does genomic context inform our understanding of YfbV function?

Comparative genomic analysis provides critical context for understanding YfbV function. Whole-genome studies of Salmonella Heidelberg isolates from different poultry production environments have revealed:

  • Specific sub-system differences between chicken and turkey farm isolates

  • Absence of type IV secretion system genes (n=12) and conjugative transfer genes (n=3) in turkey farm isolates

  • Enrichment of prophage proteins (n=53) in turkey farm isolates

These genomic differences suggest that:

  • The expression and function of membrane proteins like YfbV may be influenced by the specific genetic background

  • Horizontal gene transfer mechanisms differ between production environments

  • Phage-mediated genetic exchange may play a larger role in turkey farm isolates

To fully interpret YfbV function, researchers should consider:

  • Potential co-expression networks based on genomic proximity

  • Presence of regulatory elements affecting expression

  • Evidence of selection pressure on the yfbV gene

  • Comparison with homologous proteins in other Salmonella serovars

Complementary microbiome studies would provide additional context, particularly regarding the sources of genetic variation observed between isolates from different farm environments .

What is the relationship between YfbV and antimicrobial resistance in Salmonella Heidelberg?

Salmonella Heidelberg strains frequently display multidrug resistance profiles. While the direct role of YfbV in antimicrobial resistance has not been established in the provided sources, the genomic context provides important insights:

  • All studied Salmonella Heidelberg strains showed multidrug resistance to at least three non-β-lactam drugs (colistin, sulfamethoxazole, tetracycline)

  • Resistance to penicillin, ceftriaxone (90%), meropenem (25%), and cefoxitin (25%) was associated with blaCTX-M and blaCMY-2 genes

  • Five strains (25%) were resistant to seven tested drugs

  • Genomic analysis identified resistance to 24 classes of antibiotics that correlated with phenotypic tests

The multidrug resistance observed in Salmonella Heidelberg may be attributed to:

  • Acquired resistance genes through recombination

  • Efflux pumps (27 genes identified in some strains)

  • Permeability barriers (pmrF gene)

  • Exposure to sublethal antibiotic doses in production environments

As a membrane protein, YfbV could potentially influence resistance through:

  • Altering membrane permeability

  • Interacting with efflux pump systems

  • Contributing to biofilm formation, which enhances antimicrobial resistance

Future studies should investigate whether YfbV expression correlates with specific resistance patterns or contributes to membrane-based resistance mechanisms.

How can protein-protein interaction predictions inform experimental design for YfbV studies?

Protein-protein interaction (PPI) prediction offers valuable guidance for experimental design when studying YfbV. Research on Salmonella Heidelberg has identified:

  • Two metabolic pathways correlated with biofilm formation through PPI prediction

  • Complex interactions between virulence, resistance, and biofilm determinants

To leverage PPI predictions for YfbV research:

  • Database mining approach:

    • Search interaction databases (STRING, IntAct) for predicted interactions

    • Identify conserved interacting partners across species

    • Prioritize high-confidence interactions for experimental validation

  • Network analysis:

    • Construct interaction networks incorporating YfbV

    • Identify network hubs and bottlenecks that might represent critical functions

    • Look for enriched biological processes within the network

  • Experimental validation strategies:

    • Bacterial two-hybrid screens

    • Pull-down assays with tagged YfbV

    • Cross-linking coupled with mass spectrometry

    • Co-immunoprecipitation with candidate interactors

  • Functional correlation:

    • Test phenotypic effects of disrupting predicted interactions

    • Evaluate co-expression patterns under different conditions

    • Assess genetic linkage of interaction partners

Given the identified correlation between protein-protein interactions and biofilm formation in Salmonella Heidelberg , focusing experimental efforts on YfbV's potential role in this process would be particularly informative. The prediction of interaction networks can guide the identification of experimental conditions most likely to reveal YfbV's functional significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.