Recombinant Salmonella heidelberg UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciC; SeHA_C1924; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0259 membrane protein yciC in Salmonella heidelberg?

The UPF0259 membrane protein yciC is an uncharacterized protein found in Salmonella heidelberg strain SL476, with UniProt accession number B4TJL6 . As a membrane-associated protein, yciC likely integrates into the bacterial membrane structure, potentially contributing to cellular processes such as transport, signaling, or membrane integrity. The "UPF" designation (Uncharacterized Protein Family) indicates that while the protein's existence has been confirmed, its specific function remains to be fully elucidated through experimental investigation.

What is the optimal protocol for reconstitution and storage of recombinant yciC protein?

According to product specifications, recombinant Salmonella heidelberg UPF0259 membrane protein yciC should be reconstituted following these methodological steps:

  • Centrifuge the vial briefly before opening to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

For optimal stability, the following storage conditions are recommended:

  • Liquid form: 6 months shelf life at -20°C/-80°C

  • Lyophilized form: 12 months shelf life at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

What expression systems are suitable for producing recombinant yciC protein?

  • Bacterial expression (E. coli): Often employed for high yield but may require optimization for membrane proteins to prevent inclusion body formation or toxicity

  • Yeast expression (Pichia pastoris, Saccharomyces cerevisiae): Advantageous for eukaryotic post-translational modifications while maintaining higher yields than mammalian systems

  • Insect cell expression: Offers a compromise between proper folding and yield

  • Mammalian cell expression: Provides the most authentic post-translational modifications and protein folding environment

The choice of expression system should be guided by the intended application, whether structural studies, functional assays, or immunological research.

How can epitope mapping approaches be applied to study immunogenic properties of yciC?

Epitope mapping of recombinant Salmonella proteins can be conducted through complementary in silico and in vivo approaches, similar to methods applied to other Salmonella proteins like FlgK. A comprehensive strategy would include:

In silico prediction methods:

  • Computational analysis of the yciC sequence to predict potential B-cell epitopes based on parameters such as hydrophilicity, accessibility, and antigenicity

  • Prediction of MHC class I and II binding regions to identify T-cell epitopes

  • Structural modeling to identify surface-exposed regions likely to serve as antigenic determinants

Experimental validation methods:

  • Immunization of animal models (such as chickens) with purified recombinant yciC

  • Collection of immune sera and purification of antibodies

  • Mass spectrometry in association with immunoprecipitation proteomics to identify binding regions

  • Validation with synthetic peptides corresponding to predicted epitopes

A study on Salmonella Heidelberg FlgK protein successfully identified three consensus peptide epitope sequences (positions 77-95, 243-255, and 358-373) using both computational and experimental approaches, demonstrating the feasibility of this dual methodology for membrane proteins .

What is the potential of yciC as a component in Salmonella vaccine development?

While specific studies on yciC for vaccine development are not documented in the literature, several methodological approaches could be applied based on research with other Salmonella membrane proteins:

  • Subunit vaccine approach:

    • Purification of recombinant yciC to high homogeneity

    • Formulation with appropriate adjuvants

    • Evaluation in animal models for immunogenicity and protection

  • Epitope-based vaccine design:

    • Identification of immunodominant epitopes within yciC

    • Design of multi-epitope constructs incorporating these regions

    • Potential delivery via mRNA technology, leveraging advances from COVID-19 vaccine development

  • Live attenuated vector approach:

    • Construction of attenuated Salmonella strains expressing recombinant yciC

    • Optimization of expression using specialized plasmid vectors

    • Assessment of immune response profiles

Prior research has demonstrated that attenuated Salmonella enterica expressing recombinant antigens can induce robust immune responses. For example, a study using recombinant pneumococcal PspA antigen expressed in Salmonella induced both IgG antibodies and cell-mediated immunity, with approximately 60% protection against lethal challenge with Streptococcus pneumoniae .

The expression stability of recombinant proteins in Salmonella vectors requires careful optimization, as toxicity can lead to plasmid instability. Research has shown that high-copy-number plasmids can be lost in approximately 50% of Salmonella cells after 24 hours of growth .

How does the subcellular localization of yciC affect its immunogenicity in recombinant vaccine strategies?

The subcellular localization of recombinant antigens in Salmonella vaccine strains significantly impacts immune response profiles. For membrane proteins like yciC, strategic localization can enhance immunogenicity through several mechanisms:

What are the challenges in expressing membrane proteins like yciC for structural studies?

Membrane proteins present unique challenges for structural biology investigations compared to soluble proteins:

  • Expression challenges:

    • Toxicity to host cells during overexpression

    • Misfolding in heterologous expression systems

    • Aggregation and inclusion body formation

    • Low yields limiting structural analysis

  • Purification obstacles:

    • Selection of appropriate detergents for solubilization without disrupting native structure

    • Maintaining stability during purification steps

    • Achieving sufficient purity (>85% by SDS-PAGE for commercial preparations)

    • Removing detergents without causing aggregation

  • Crystallization difficulties:

    • Obtaining well-diffracting crystals for X-ray crystallography

    • Identifying suitable crystallization conditions that accommodate detergent micelles

    • Limited conformational stability affecting reproducibility

  • Expression system considerations:

    • Bacterial systems may lack appropriate post-translational modifications

    • Mammalian expression systems provide better folding but lower yields

    • Yeast or insect cell systems may offer compromise solutions

How can outer membrane proteins from Salmonella serve as adjuvants in vaccine formulations?

Outer membrane proteins (OMPs) from Salmonella species demonstrate significant adjuvant properties that could be relevant when considering yciC for vaccine applications:

  • Mechanism of adjuvant action:

    • Salmonella OMPs interact with pattern recognition receptors, particularly TLR2 and TLR4

    • This interaction links innate and adaptive immune responses

    • Multiple proteins in S. Typhi outer membrane contribute to this effect, including OmpA, OmpC, OmpF, OmpS1, and OmpS2

  • Immune response enhancement:

    • Studies show OMP-adjuvanted vaccines induce significantly higher neutralizing antibody titers

    • For example, OMP-adjuvanted rabies vaccine produced higher antibodies on day 21 post-vaccination compared to alum-adjuvanted formulations

    • OMP adjuvants induce significantly higher levels of IFN-γ, promoting cellular immunity

  • T-cell response modulation:

    • OMP adjuvants influence T-cell subset activation

    • CD8+ T cells are significantly higher with OMP-adjuvanted vaccines compared to alum-adjuvanted formulations

    • Salmonella porins drive T-cell responses toward a Th1/Th17 profile rather than Th2

  • Safety profile:

    • Biochemical analysis and histopathological examination support the safety of OMPs as adjuvants

    • This makes them attractive alternatives to traditional adjuvants like alum

Table 1: Comparison of immune responses to different adjuvant formulations

Immune ParameterOMP-adjuvanted vaccineAlum-adjuvanted vaccineUnadjuvanted vaccine
Neutralizing antibodies (Day 21)Significantly higherModerateLower
IFN-γ levels (Day 14)Significantly higherModerate increaseBaseline
CD8+ T cell proliferationSignificantly elevatedLowerModerate
CD4+ T cell proliferationModerateSignificantly elevatedLower

What methodologies are most effective for studying protein-protein interactions involving yciC?

Investigating protein-protein interactions involving membrane proteins like yciC requires specialized techniques:

  • In vitro approaches:

    • Pull-down assays using purified recombinant yciC with appropriate affinity tags

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic characterization

    • Cross-linking coupled with mass spectrometry to identify interaction sites

  • Cell-based approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation from membrane fractions

    • Proximity labeling methods (BioID, APEX) for capturing transient interactions

    • Fluorescence resonance energy transfer (FRET) for monitoring dynamic interactions

  • Bioinformatic prediction:

    • Computational prediction of interaction networks based on homology

    • Structural modeling of potential interaction interfaces

    • Co-evolution analysis to identify potential binding partners

Immunoprecipitation combined with mass spectrometry has been successfully used for epitope mapping of Salmonella proteins and could be adapted to study the yciC interactome .

How can serotype-specific variations in yciC be leveraged for diagnostic applications?

While specific information about yciC variation across Salmonella serotypes is limited, methodological approaches for exploiting potential variation include:

  • Sequence analysis across serotypes:

    • Comparative genomic analysis focusing on the yciC gene region

    • Identification of serotype-specific SNPs or sequence variations

    • Development of PCR-based assays targeting variable regions

  • Antibody-based detection:

    • Generation of monoclonal antibodies against conserved and variable regions

    • Development of immunoassays for Salmonella heidelberg-specific detection

    • Validation against panels of different Salmonella serotypes

  • Integration with existing typing methods:

    • Incorporation of yciC analysis into intergenic sequence region (ISR) databases used for serotype screening

    • Combination with other markers for improved discrimination

The considerable genomic heterogeneity observed in Salmonella enterica (with 36.9% of sequences having no match in NCBI databases) suggests potential for discovering unique diagnostic targets within proteins like yciC .

What animal models are most appropriate for evaluating yciC-based vaccines?

Selection of appropriate animal models for yciC-based vaccine evaluation should consider:

  • Chicken models:

    • Highly relevant as Salmonella heidelberg is frequently associated with poultry

    • Allow assessment of colonization, shedding, and transmission dynamics

    • Enable evaluation of vaccine efficacy in reducing human exposure through poultry products

    • Previously used successfully for epitope mapping studies of Salmonella proteins

  • Mouse models:

    • Well-characterized immune system with available reagents

    • Allow comparison of wild-type and yciC mutant strains

    • Facilitate assessment of protective efficacy through challenge studies

    • Enable investigation of immune correlates of protection

  • Rat models:

    • Used successfully for immunogenicity testing of Salmonella outer membrane proteins

    • Studies with Sprague Dawley albino rats have demonstrated utility for evaluating both humoral and cellular immune responses to Salmonella antigens

The selection of model should align with specific research questions, with chickens being particularly appropriate for studies focused on reducing Salmonella heidelberg in poultry production .

What is the recommended experimental design for evaluating epitope-based vaccines derived from yciC?

A comprehensive experimental design for evaluating epitope-based vaccines derived from yciC would include:

  • Epitope identification and selection:

    • In silico prediction of B and T cell epitopes within yciC

    • Synthesis of candidate epitope peptides

    • Screening for binding to MHC molecules and serum antibodies

    • Selection of epitopes conserved across Salmonella heidelberg strains

  • Vaccine formulation optimization:

    • Design of multi-epitope constructs with appropriate linkers

    • Selection of delivery platform (peptide, recombinant protein, DNA, or mRNA)

    • Adjuvant selection (with consideration of Salmonella OMPs as potential adjuvants)

    • Stability and immunogenicity testing of formulations

  • Immunization protocol:

    • Determination of optimal dose, route, and schedule

    • Collection of sera for antibody analysis

    • Isolation of lymphocytes for cellular response assessment

    • Monitoring of IgG subtypes to characterize Th1/Th2 balance

  • Challenge studies:

    • Selection of appropriate Salmonella heidelberg challenge strain

    • Determination of challenge dose and route

    • Assessment of protection parameters (survival, bacterial load, pathology)

    • Analysis of immune correlates of protection

A similar approach using the FlgK protein identified three consensus peptide epitope sequences with potential for vaccine development, demonstrating the feasibility of this methodology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.