Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella heidelberg UPF0266 Membrane Protein yobD (yobD)

The Recombinant Salmonella heidelberg UPF0266 membrane protein yobD (yobD) is a protein derived from the bacterium Salmonella Heidelberg, a serovar of Salmonella enterica. This protein is encoded by the yobD gene and is classified as a UPF0266 membrane protein. The recombinant form of this protein is produced in Escherichia coli (E. coli) and is often used in research and vaccine development due to its potential role in bacterial pathogenicity and immune response modulation.

Characteristics of Recombinant Salmonella heidelberg UPF0266 Membrane Protein yobD (yobD)

  • Protein Length and Structure: The recombinant yobD protein is full-length, spanning 152 amino acids (1-152 aa) .

  • Source: Expressed in E. coli .

  • Tag: The protein is fused with an N-terminal His tag, facilitating purification and detection .

  • Form: Supplied as a lyophilized powder .

  • Purity: Greater than 90% as determined by SDS-PAGE .

  • Amino Acid Sequence: MTITDLVLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ .

Comparison with Other Salmonella Proteins

Other proteins in Salmonella, such as SanA and YfdX, have been studied for their roles in membrane modification, antibiotic resistance, and virulence. SanA affects membrane permeability and hydrophilicity, impacting antibiotic resistance . YfdX influences bacterial susceptibility to antibiotics and modulates virulence . These studies highlight the complex interplay between membrane proteins and bacterial pathogenicity.

Table 1: Characteristics of Recombinant Salmonella heidelberg UPF0266 Membrane Protein yobD (yobD)

CharacteristicDescription
Protein LengthFull Length (1-152 aa)
SourceE. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage Conditions-20°C or -80°C

Table 2: Comparison with Other Salmonella Proteins

ProteinFunctionImpact on Bacteria
yobDMembrane proteinPotential role in pathogenicity and immune response modulation
SanAModifies membrane permeability and hydrophilicityEnhances resistance to certain antibiotics
YfdXInfluences antibiotic susceptibility and virulenceImpacts bacterial survival and infection severity

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
yobD; SeHA_C2033; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the general characteristics of membrane proteins in Salmonella heidelberg?

Salmonella heidelberg membrane proteins vary in size and function but typically play crucial roles in bacterial virulence, antimicrobial resistance, and host interaction. Based on well-studied examples like the FlgK protein, these proteins often display conserved structures among different Salmonella heidelberg isolates. The FlgK protein, for instance, contains 553 amino acids with a molecular mass of approximately 59.11 kDa and a theoretical pI of 4.79 . This high degree of conservation (>97% among Salmonella serovars) is characteristic of many functionally important membrane proteins and makes them potential targets for vaccine development. When working with membrane proteins, researchers should analyze their physicochemical properties including instability index, aliphatic index, and grand average of hydropathicity (GRAVY) to predict protein stability and solubility characteristics .

What methodologies are commonly used for cloning and expressing recombinant Salmonella heidelberg proteins?

Recombinant protein expression for Salmonella proteins typically involves cloning the target gene into an expression vector and transforming it into a suitable host system, most commonly Escherichia coli. As demonstrated in studies with the FlgK protein, researchers clone the target gene, express it in E. coli, and then purify the recombinant protein using appropriate chromatography techniques . The purified protein is then typically emulsified with an adjuvant like Freund's incomplete adjuvant for immunization studies. The expression protocol should be optimized based on the specific physicochemical properties of the target protein, with special consideration for membrane proteins that may require detergent solubilization or fusion partners to enhance solubility and proper folding .

How does protein conservation among Salmonella serovars impact vaccine development research?

Protein conservation among Salmonella serovars is a critical factor in vaccine development research. Studies on the FlgK protein have shown that the degree of conservation among different Salmonella serovars exceeds 97% . This high level of conservation suggests that proteins like FlgK may be excellent vaccine candidates capable of inducing cross-reactive antibodies against multiple Salmonella serovars. When selecting target proteins for vaccine development, researchers should analyze sequence conservation not only within a specific serotype like S. heidelberg but also across clinically relevant serovars including S. Typhimurium, S. Typhi, S. Paratyphi, S. Choleraesuis, and S. Enteritidis. This cross-serovar protection potential is particularly valuable for developing broadly protective vaccines against multiple Salmonella strains that cause foodborne illnesses in humans .

What are the optimal approaches for epitope mapping of recombinant Salmonella heidelberg membrane proteins?

Epitope mapping of Salmonella heidelberg membrane proteins can be effectively conducted using complementary in silico and in vivo approaches. For in silico prediction, researchers should employ multiple B-cell epitope prediction algorithms including Bepipred Linear Epitope Prediction, Emini Surface Accessibility, Karplus and Schulz Flexibility, Kolaskar and Tongaonkar Antigenicity, and Parker Hydrophilicity . Each algorithm analyzes different physicochemical properties and may predict a varying number of potential epitopes. For instance, Bepipred software typically predicts 15 potential epitope peptides, while Kolaskar and Tongaonkar antigenicity software may predict 18 potential epitope peptides for the same protein .

For in vivo experimental validation, the epitope extraction method has proven effective. This involves proteolytic digestion of the antigen with trypsin, followed by binding to antibodies generated in animal models and detection using mass spectrometry . When comparing in silico predictions with in vivo results, researchers should focus on consensus epitopes identified by both approaches, as these represent the most promising candidates for vaccine development. For example, in the case of FlgK protein, three consensus epitope sequences (positions 77-95, 243-255, and 358-373) were identified by both computational and experimental methods .

How should researchers interpret discrepancies between in silico predicted epitopes and in vivo experimental results?

Discrepancies between in silico predictions and in vivo experimental results are common in epitope mapping studies and should be carefully analyzed. These discrepancies may arise from several factors:

For computational approaches, prediction tools use algorithms with thresholds typically set below 0.6, which affects epitope prediction accuracy . Each algorithm uses different parameters based on various physicochemical properties, resulting in variations in predicted epitopes. Researchers should consider these predictions as hypotheses requiring experimental validation rather than definitive results.

For in vivo experimental studies, multiple factors can affect epitope mapping outcomes:

  • Proteolytic enzyme selection and digestion patterns around epitopes may limit detection

  • Antibody quality and specificity (monoclonal versus polyclonal) impact binding efficiency

  • Cross-reactivity with proteins from microorganisms in animal gut microbiomes may produce false positives

  • Genetic variations in animal immunoglobulin repertoires can affect responses to the target protein

  • Antibody affinity in individual serum samples may vary, resulting in inconsistent detection

When encountering discrepancies, researchers should prioritize epitopes detected by multiple prediction tools and confirmed by experimental methods, while continuing to investigate epitopes uniquely identified by either approach through additional validation studies .

What physicochemical analysis should be performed when characterizing novel Salmonella heidelberg membrane proteins?

When characterizing novel Salmonella heidelberg membrane proteins, researchers should conduct comprehensive physicochemical analyses including:

Physicochemical PropertyAnalytical Method/ToolSignificance in Protein Characterization
Amino acid compositionProtParam tool (ExPASy server)Determines basic protein parameters
Molecular massMass spectrometry, ExPASy serverConfirms protein identity and purity
Theoretical pIExPASy server calculationPredicts protein behavior in solution
Instability index (II)ProtParam analysisPredicts protein stability (stable if <40)
Aliphatic indexProtParam analysisIndicates thermostability (higher values = more stable)
Hydropathicity (GRAVY)ProtParam analysisDetermines hydrophilic/hydrophobic nature
AntigenicityVaxiJen software (v2.0)Predicts protective antigen potential
AllergenicityAllerTOP (v2.0)Assesses potential allergenic properties
ToxicityToxinPred toolEvaluates potential toxic properties
SolubilityProtein-Sol serverPredicts physiological behavior
Adhesion propertiesVaxign2 web-based programPredicts potential for host cell adhesion

This comprehensive analysis provides critical insights into protein properties and behavior. For example, the FlgK protein with an aliphatic index of 84.34, instability index of 30.10, and GRAVY of -0.363 indicates a thermostable, generally stable, and hydrophilic protein . These properties inform optimal conditions for protein expression, purification, and storage, as well as predict potential vaccine applications.

How does multidrug resistance in Salmonella heidelberg impact research approaches for vaccine development?

Multidrug resistance (MDR) in Salmonella heidelberg significantly impacts vaccine development research strategies. Outbreaks of MDR S. heidelberg infections have shown resistance to multiple antibiotic classes, including first-line treatments for severe salmonellosis such as ampicillin, ceftriaxone, and ciprofloxacin . This resistance profile increases the urgency and importance of developing effective vaccines as preventive measures.

When researching vaccines against MDR S. heidelberg, researchers should:

  • Target conserved antigens that are essential for bacterial virulence or survival, reducing the likelihood of mutation-based escape

  • Focus on proteins involved in antimicrobial resistance mechanisms as potential vaccine targets

  • Develop combination vaccines targeting multiple antigens to prevent escape mutants

  • Consider both humoral and cell-mediated immune responses in vaccine design

  • Evaluate cross-protection against multiple resistant strains

MDR S. heidelberg strains are associated with increased risk of bloodstream infections and hospitalization, making them serious human health threats . Therefore, vaccine development research must prioritize targets that can effectively prevent colonization and infection by these resistant strains, particularly in agricultural settings where zoonotic transmission occurs .

What are the critical considerations when evaluating recombinant Salmonella proteins as vaccine candidates for cross-serovar protection?

When evaluating recombinant Salmonella proteins as vaccine candidates for cross-serovar protection, researchers must consider several critical factors:

  • Sequence conservation: Analyze protein conservation across multiple clinically relevant Salmonella serovars. Ideal candidates show >97% conservation, as seen with the FlgK protein .

  • Essential virulence function: Target proteins that play essential roles in bacterial pathogenesis, such as flagellar proteins (FlgK), outer membrane proteins, or adhesins that are required for colonization and infection .

  • Immunogenicity assessment: Evaluate both B-cell and T-cell epitopes to ensure robust immune responses. Use complementary in silico prediction and in vivo experimental validation approaches .

  • Epitope accessibility: Consider protein topography and membrane localization to ensure epitopes are accessible to the immune system, particularly for membrane-associated proteins .

  • Immunological cross-reactivity: Test antibodies generated against the recombinant protein for cross-reactivity with multiple Salmonella serovars using techniques like ELISA, immunoblotting, and functional assays .

  • Animal model validation: Evaluate vaccine candidates in relevant animal models to assess protection against challenge with different Salmonella serovars .

  • Production feasibility: Consider protein expression efficiency, stability, and purification yields when selecting vaccine candidates for further development .

Proteins like FlgK that demonstrate high conservation among serovars causing foodborne illnesses (S. Typhimurium, S. Enteritidis, S. Heidelberg) and typhoidal fever (S. Typhi, S. Paratyphi) offer the greatest potential for broad protection .

How should researchers design challenge studies to evaluate vaccine efficacy against Salmonella heidelberg infections?

Designing effective challenge studies to evaluate vaccine efficacy against Salmonella heidelberg infections requires careful consideration of multiple factors:

  • Animal model selection: Choose appropriate models that recapitulate human or relevant animal disease. For Salmonella heidelberg, broiler chickens represent an appropriate model given the zoonotic transmission pathway .

  • Immunization protocol:

    • Determine optimal antigen dose (typically 100 μg of recombinant protein per animal)

    • Select appropriate adjuvant (Freund's incomplete adjuvant is commonly used)

    • Establish primary and booster vaccination schedule (e.g., primary at one week of age, booster at three weeks)

    • Define administration route (subcutaneous injection is standard for protein subunit vaccines)

  • Challenge strain selection:

    • Use well-characterized virulent Salmonella heidelberg strains

    • Include multidrug-resistant clinical isolates to assess protection against relevant threats

    • Consider using multiple strains to evaluate cross-protection

  • Challenge protocol:

    • Determine optimal challenge timing (typically 2-3 weeks after booster vaccination)

    • Define challenge dose based on preliminary LD50 studies

    • Select appropriate challenge route (oral gavage to mimic natural infection)

  • Efficacy endpoints:

    • Monitor bacterial colonization in intestinal tissues and systemic organs

    • Track bacterial shedding patterns to assess transmission risk

    • Evaluate clinical signs and mortality rates

    • Measure immune responses (antibody titers, cellular immunity)

    • Assess weight gain and production parameters in agricultural species

  • Controls:

    • Include unvaccinated challenged groups

    • Include adjuvant-only controls

    • Consider commercial vaccine comparators if available

  • Statistical considerations:

    • Perform power analysis to determine appropriate group sizes

    • Plan for appropriate statistical analysis of multiple endpoints

    • Account for animal-to-animal variation in responses

These comprehensive challenge studies provide critical data on vaccine efficacy and guide optimization of vaccination strategies against Salmonella heidelberg infections .

What structural analyses should be performed to understand Salmonella membrane protein function and antigenicity?

To thoroughly understand Salmonella membrane protein function and antigenicity, researchers should perform comprehensive structural analyses that include:

  • Primary structure analysis:

    • Complete amino acid sequence determination

    • Identification of conserved domains and motifs

    • Prediction of post-translational modifications

    • Comparison with homologous proteins across bacterial species

  • Secondary structure prediction:

    • Analyze α-helices, β-sheets, and random coils distribution

    • Identify transmembrane domains in membrane proteins

    • Predict surface-exposed regions versus buried segments

  • Tertiary structure analysis:

    • X-ray crystallography or cryo-electron microscopy for experimental structure determination

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to predict protein flexibility and behavior in membrane environments

  • Epitope structural analysis:

    • Map predicted B-cell epitopes onto three-dimensional structures

    • Assess epitope accessibility on protein surface

    • Evaluate epitope flexibility and dynamics

    • Analyze binding potential to antibodies or immune receptors

  • Functional domain mapping:

    • Identify catalytic sites or binding domains

    • Correlate structural features with known protein functions

    • Investigate structure-based mechanisms of antimicrobial resistance

  • Protein-protein interaction analysis:

    • Predict protein-protein interaction interfaces

    • Investigate oligomerization properties

    • Study complex formation with host receptors or immune components

The integration of structural data with functional and antigenic properties provides comprehensive understanding of how protein structure influences bacterial virulence, immune recognition, and vaccine potential. For membrane proteins, special attention should be given to the orientation within the membrane and accessibility of potential epitopes to the immune system .

How do modifications to recombinant protein expression systems affect protein folding and epitope presentation?

Modifications to recombinant protein expression systems can significantly impact protein folding and epitope presentation, especially for membrane proteins from Salmonella. Researchers should consider several key factors:

  • Expression host selection:

    • E. coli remains the most common expression host for Salmonella proteins but may lack specific chaperones for proper folding

    • Alternative hosts like Bacillus subtilis or yeast systems may provide better folding environments for certain proteins

    • Cell-free expression systems can reduce toxicity issues but may lack membrane-mimicking environments

  • Expression vector design:

    • Fusion partners (His-tag, GST, MBP, SUMO) can improve solubility but may mask epitopes

    • Signal peptides direct proteins to specific cellular compartments affecting folding

    • Codon optimization improves expression but may alter translation kinetics affecting folding

  • Expression conditions:

    • Reduced temperature (16-25°C) typically improves proper folding

    • Inducer concentration modulation can balance expression rate with folding capacity

    • Co-expression of molecular chaperones enhances proper folding

  • Membrane protein considerations:

    • Detergent selection for solubilization affects tertiary structure

    • Lipid composition in reconstitution systems influences membrane protein orientation

    • Nanodiscs or liposomes better mimic native membrane environments

  • Post-translational modifications:

    • Bacterial systems lack eukaryotic modifications potentially affecting structure

    • Glycosylation affects protein folding and epitope recognition

    • Disulfide bond formation requires oxidizing environments or enzymes

  • Protein refolding strategies:

    • Step-wise dialysis protocols for inclusion body processing

    • Chaperone-assisted refolding improves native structure recovery

    • On-column refolding during purification can enhance yield

When evaluating recombinant proteins as vaccine candidates, researchers must verify that key epitopes maintain their native conformation and accessibility. Methods such as circular dichroism spectroscopy, intrinsic fluorescence, and reactivity with conformation-specific antibodies help assess proper folding. For membrane proteins, reconstitution in membrane-mimicking environments is crucial for preserving native epitope presentation .

What are the correlation patterns between protein structural features and antimicrobial resistance in Salmonella heidelberg?

The correlation between protein structural features and antimicrobial resistance in Salmonella heidelberg represents a complex relationship that requires interdisciplinary analysis. While specific information on yobD protein's role in antimicrobial resistance is limited, general patterns in Salmonella resistance mechanisms can be analyzed:

  • Transmembrane domain modifications:

    • Alterations in transmembrane domains of efflux pump proteins enhance extrusion of antibiotics

    • Mutations in porin proteins modify channel size or charge distribution, restricting antibiotic entry

    • Thickness and composition changes in membrane proteins affect membrane permeability to antibiotics

  • Active site modifications in target enzymes:

    • Structural changes in binding pockets reduce antibiotic affinity while preserving enzymatic function

    • Allosteric modifications alter enzyme conformation preventing antibiotic binding

    • Secondary structure rearrangements shield vulnerable enzyme regions from antibiotic interaction

  • Protein-protein interaction interfaces:

    • Alterations in protein complexes involved in cell wall synthesis confer resistance to beta-lactams

    • Modified ribosomal protein interactions reduce binding of aminoglycosides and tetracyclines

    • Changes in DNA gyrase-DNA interactions decrease fluoroquinolone effectiveness

  • Acquired resistance proteins:

    • Beta-lactamases with expanded substrate specificity through active site mutations

    • Aminoglycoside-modifying enzymes with optimized binding pockets for various antibiotics

    • Target protection proteins that physically shield ribosomal binding sites

  • Regulatory proteins:

    • Mutations in transcriptional regulators leading to overexpression of resistance mechanisms

    • Two-component regulatory systems with modified sensor domains triggering resistance responses

    • Altered protein turnover affecting expression levels of resistance determinants

MDR Salmonella heidelberg strains showing resistance to multiple antibiotic classes, including first-line treatments like ampicillin, ceftriaxone, and ciprofloxacin, typically harbor multiple resistance mechanisms . Understanding the structural basis of these resistance mechanisms is essential for developing strategies to overcome resistance and for designing vaccines targeting conserved epitopes that are less likely to undergo resistance-conferring mutations .

What novel delivery systems are being developed for recombinant Salmonella protein vaccines?

Recent advances in delivery systems for recombinant Salmonella protein vaccines reflect significant innovation in improving vaccine efficacy and administration:

  • mRNA vaccine technology:

    • Following the success of mRNA vaccines for COVID-19, researchers are exploring mRNA encoding for Salmonella proteins as an alternative to traditional protein vaccines

    • mRNA encoding desired proteins/epitopes may replace traditional peptide/protein vaccines for Salmonella

    • This approach allows for in vivo production of properly folded proteins with native post-translational modifications

  • Multi-epitope vaccine constructs:

    • Rational design of synthetic proteins containing multiple protective epitopes from different Salmonella proteins

    • Several recent studies have applied immunoinformatic tools to design multi-epitope vaccines against Salmonella

    • These constructs can incorporate epitopes from multiple proteins, including membrane proteins, flagellar proteins, and virulence factors

  • Nanoparticle-based delivery:

    • Encapsulation of recombinant proteins in biodegradable nanoparticles for controlled release

    • Lipid nanoparticles protect antigens from degradation and enhance uptake by antigen-presenting cells

    • Surface modification with targeting ligands improves delivery to specific immune cell populations

  • Attenuated vector systems:

    • Use of attenuated Salmonella strains as live vectors expressing heterologous antigens

    • Expression of antigens from other Salmonella serotypes to provide cross-protection

    • Genetic engineering to enhance immunogenicity while reducing reactogenicity

  • Mucoadhesive formulations:

    • Development of oral formulations with enhanced intestinal mucosa adhesion

    • Protection of antigens from gastric degradation

    • Targeted delivery to M cells and Peyer's patches in the intestinal mucosa

  • Adjuvant innovations:

    • Novel adjuvant formulations to enhance immune responses to recombinant proteins

    • Combinations of TLR agonists with conventional adjuvants

    • Cytokine-adjuvant combinations for tailored immune response profiles

These delivery systems aim to overcome limitations of traditional recombinant protein vaccines, including poor immunogenicity, inadequate mucosal responses, and manufacturing challenges. The research on mRNA vaccine technology for Salmonella antigens represents a particularly promising direction based on recent successes with other pathogens .

How can immunoinformatic approaches improve epitope selection for next-generation Salmonella vaccines?

Immunoinformatic approaches offer powerful tools for epitope selection in next-generation Salmonella vaccines, providing systematic and data-driven strategies:

  • Integrated epitope prediction pipelines:

    • Combine multiple prediction algorithms to increase confidence in epitope identification

    • Integrate B-cell and T-cell epitope predictions for comprehensive immune response

    • Incorporate structural information to confirm epitope accessibility

    • Example: For the FlgK protein, utilizing multiple prediction tools (Bepipred, Emini Surface Accessibility, Karplus and Schulz Flexibility, etc.) identified consensus epitopes that were later validated experimentally

  • Population coverage analysis:

    • Predict epitope binding to diverse MHC alleles across human populations

    • Ensure vaccine efficacy across genetically diverse populations

    • Identify universally recognized epitopes for broad protection

  • Epitope conservation analysis:

    • Assess epitope conservation across Salmonella serovars and strains

    • Identify epitopes conserved in multiple clinically relevant serovars

    • Avoid regions prone to mutation or antigenic variation

    • As demonstrated with FlgK protein showing >97% conservation across Salmonella serovars

  • Reverse vaccinology approach:

    • Analyze entire bacterial genomes to identify potential vaccine antigens

    • Prioritize surface-exposed and secreted proteins

    • Filter candidates based on immunogenic potential and conservation

    • This approach was successfully used for Neisseria meningitidis serotype B vaccines

  • Epitope-based vaccine design:

    • Construct multi-epitope vaccines containing optimized epitope combinations

    • Include promiscuous epitopes recognized by multiple MHC alleles

    • Incorporate both B-cell and T-cell epitopes for comprehensive immunity

    • Add immunomodulatory sequences to enhance immune responses

    • Several recent studies have applied these tools to design multi-epitope vaccines against Salmonella

  • Experimental validation integration:

    • Combine in silico predictions with experimental validation

    • Prioritize epitopes identified by both computational and experimental methods

    • Use machine learning to refine prediction algorithms based on experimental data

    • In the FlgK study, three epitopes (positions 77-95, 243-255, and 358-373) were identified by both approaches

These immunoinformatic approaches reduce the cost and time of vaccine development by narrowing down candidates before experimental testing. The successful identification of consensus epitopes in the FlgK protein demonstrates the value of combining computational prediction with experimental validation for efficient and effective vaccine design .

What are the current challenges and solutions in scaling up production of recombinant Salmonella membrane proteins for vaccine development?

Scaling up production of recombinant Salmonella membrane proteins for vaccine development presents several challenges and corresponding solutions:

  • Membrane protein expression barriers:

    • Challenge: Low expression levels and toxicity to host cells

    • Solutions:

      • Use specialized expression strains (C41, C43) designed for membrane protein expression

      • Employ tightly regulated promoter systems to control expression levels

      • Develop cell-free expression systems for toxic proteins

      • Optimize codon usage for the expression host while maintaining proper folding kinetics

  • Protein solubility and folding issues:

    • Challenge: Inclusion body formation and improper folding

    • Solutions:

      • Express as fusion proteins with solubility-enhancing partners (MBP, SUMO, thioredoxin)

      • Optimize culture conditions (temperature, media composition, induction parameters)

      • Co-express with molecular chaperones and folding catalysts

      • Develop efficient refolding protocols for inclusion body processing

  • Purification scale-up difficulties:

    • Challenge: Maintaining protein integrity during large-scale purification

    • Solutions:

      • Develop simplified purification schemes with fewer steps

      • Optimize detergent selection for membrane protein solubilization

      • Implement tangential flow filtration for large-volume processing

      • Use automated chromatography systems with in-line monitoring

  • Protein stability concerns:

    • Challenge: Limited shelf-life of purified membrane proteins

    • Solutions:

      • Identify stabilizing buffer conditions through high-throughput screening

      • Develop lyophilization protocols with appropriate cryoprotectants

      • Explore protein engineering to enhance intrinsic stability

      • Implement controlled temperature supply chains

  • Analytical characterization challenges:

    • Challenge: Comprehensive quality control for complex membrane proteins

    • Solutions:

      • Develop robust analytical methods for identity, purity, and potency

      • Implement multiple orthogonal methods for structural characterization

      • Establish in-process controls for consistent production

      • Validate functional assays correlating with protective efficacy

  • Regulatory considerations:

    • Challenge: Meeting regulatory requirements for vaccine components

    • Solutions:

      • Implement current Good Manufacturing Practices (cGMP) early in development

      • Develop well-characterized reference standards

      • Establish quality-by-design approaches for process optimization

      • Create comprehensive documentation trails for regulatory submissions

The successful development of recombinant Salmonella FlgK protein for experimental studies provides a template for addressing these challenges . By systematically optimizing expression, purification, and characterization methods, researchers can overcome the technical barriers to large-scale production of membrane proteins while maintaining their structural integrity and immunological properties essential for effective vaccine development.

What are the most promising future directions for Salmonella heidelberg protein research?

The most promising future directions for Salmonella heidelberg protein research encompass several innovative approaches based on current scientific understanding:

  • Comprehensive multi-omics integration:

    • Combining genomics, proteomics, and immunomics data to identify novel protein targets

    • Correlating protein expression patterns with virulence and antimicrobial resistance

    • Developing predictive models for protein function and immunogenicity

  • Structure-based vaccine design:

    • Utilizing high-resolution structural information to design optimized antigens

    • Engineering proteins with enhanced stability and immunogenicity

    • Creating chimeric proteins displaying multiple protective epitopes in optimal conformations

  • mRNA vaccine technology application:

    • Developing mRNA vaccines encoding Salmonella membrane proteins

    • Optimizing mRNA stability and translation efficiency for membrane protein expression

    • Creating polycistronic mRNA constructs expressing multiple antigens

  • One Health approach to vaccine development:

    • Designing vaccines effective in both reservoir animals and humans

    • Targeting proteins essential for zoonotic transmission

    • Implementing vaccination strategies at agricultural and food production levels to prevent human outbreaks

  • Addressing antimicrobial resistance:

    • Identifying conserved epitopes in proteins conferring antimicrobial resistance

    • Developing vaccines targeting multidrug-resistant strains

    • Creating combination approaches with both vaccination and novel antimicrobials

  • Advanced delivery systems:

    • Developing oral vaccine formulations for mucosal immunity

    • Creating nanoparticle-based delivery platforms for enhanced antigen presentation

    • Designing controlled-release systems for single-dose vaccination

  • Artificial intelligence applications:

    • Using machine learning to predict protective antigens and epitopes

    • Developing AI-assisted vaccine design pipelines

    • Creating computational models to predict vaccine efficacy across populations

These research directions address the most pressing challenges in Salmonella control, including antimicrobial resistance, zoonotic transmission, and the need for broadly protective vaccines. By combining innovative technologies with fundamental understanding of Salmonella protein structure and function, researchers can develop next-generation solutions for preventing and controlling Salmonella heidelberg infections .

How does the emergence of multidrug-resistant Salmonella heidelberg impact public health research priorities?

The emergence of multidrug-resistant (MDR) Salmonella heidelberg has significantly reshaped public health research priorities, creating urgent needs for alternative control strategies:

  • Enhanced surveillance systems:

    • Integration of human and animal health surveillance (One Health approach)

    • Real-time monitoring of resistance patterns in clinical and agricultural settings

    • Whole genome sequencing of outbreak strains to track transmission and resistance spread

    • This priority emerged from outbreaks where MDR S. heidelberg spread from sick calves to humans

  • Alternative intervention strategies:

    • Accelerated vaccine development targeting conserved proteins

    • Bacteriophage therapy as an alternative to antibiotics

    • Anti-virulence approaches targeting bacterial pathogenesis without selection pressure

    • These alternatives are critical as MDR S. heidelberg shows resistance to first-line antibiotics including ampicillin, ceftriaxone, and ciprofloxacin

  • Agricultural practice modifications:

    • Reduced antimicrobial use in food animal production

    • Implementation of biosecurity measures to prevent introduction and spread

    • Vaccination programs for livestock to reduce Salmonella prevalence

    • These changes address the zoonotic transmission pathway identified in MDR outbreaks

  • Diagnostic development:

    • Rapid diagnostics for resistance profile determination

    • Point-of-care testing for both veterinary and human medicine

    • Multiplexed assays detecting multiple resistance determinants

    • Enhanced diagnostics are essential as MDR strains are associated with increased risk of bloodstream infections and hospitalization

  • Treatment guideline revisions:

    • Updated empiric therapy recommendations based on resistance patterns

    • Treatment algorithms incorporating rapid diagnostic results

    • Antibiotic stewardship programs to preserve remaining effective antibiotics

    • These changes respond to resistance affecting first-line treatments for severe salmonellosis

  • Economic impact assessments:

    • Cost-benefit analyses of intervention strategies

    • Healthcare burden quantification of MDR infections

    • Modeling of resistance transmission and control measures

    • Economic data informs policy decisions and resource allocation

The increasing prevalence of MDR Salmonella heidelberg with resistance to critical antibiotics represents a serious public health threat requiring coordinated research efforts spanning human medicine, veterinary science, agriculture, and public health policy. The zoonotic nature of these outbreaks emphasizes the importance of the One Health approach in addressing this complex challenge .

What collaborative research frameworks are needed to accelerate Salmonella vaccine development?

Accelerating Salmonella vaccine development requires robust collaborative research frameworks that integrate expertise across disciplines and sectors:

  • Public-private partnerships:

    • Collaboration between academic institutions, government agencies, and industry

    • Shared resources and complementary expertise

    • Accelerated translation of basic research to commercial products

    • Risk-sharing arrangements for clinical development

  • One Health research networks:

    • Integration of human, animal, and environmental health researchers

    • Coordinated surveillance across sectors

    • Shared sample and data repositories

    • Synchronized intervention studies in humans and animal reservoirs

    • This approach is particularly vital given the zoonotic transmission of MDR Salmonella heidelberg from calves to humans

  • Global research consortia:

    • International collaboration addressing Salmonella as a global health challenge

    • Standardized protocols and reagents for cross-study comparisons

    • Multi-site clinical trials in diverse populations

    • Capacity building in endemic regions

  • Interdisciplinary research teams:

    • Integration of immunologists, microbiologists, structural biologists, and bioinformaticians

    • Computational and experimental approaches in parallel

    • Systems biology perspectives on host-pathogen interactions

    • This integration is exemplified in studies combining in silico prediction with in vivo experiments for epitope mapping

  • Regulatory science advancement:

    • Collaboration with regulatory agencies early in development

    • Development of novel approaches for evaluating vaccine safety and efficacy

    • Streamlined pathways for urgent public health needs

    • Harmonization of international regulatory requirements

  • Open science initiatives:

    • Pre-competitive data sharing among researchers

    • Open-access publication of methods and results

    • Shared bioinformatic tools and databases

    • Collaborative problem-solving for technical challenges

  • End-user engagement framework:

    • Input from healthcare providers, public health officials, and at-risk populations

    • Consideration of implementation challenges in diverse settings

    • Culturally appropriate education and outreach strategies

    • Economic assessments of vaccine cost-effectiveness

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.