Recombinant Salmonella heidelberg UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for prioritized development.
Synonyms
ycjF; SeHA_C1870; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEESTSAFKAQQTFSEAESRTFAPAAIDERPEDEGAAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYANLVQPVLDAQARREISRFAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the ycjF gene regulated in Salmonella heidelberg?

The regulation of ycjF expression appears to be related to stress responses in Salmonella. Research has shown that ycjF is upregulated during various stress conditions, including heat shock and phage infection . Gene expression studies have demonstrated that ycjF has a fold change of approximately 1.25 during heat stress conditions . Furthermore, ycjF is associated with the phage shock protein (PSP) response and shows significant upregulation at both transcriptional and protein levels during bacteriophage ΦX174 infection . This indicates that ycjF plays a role in bacterial stress adaptation and survival mechanisms.

What are the optimal methods for extracting and purifying recombinant ycjF protein from bacterial membranes?

Extraction and purification of membrane-bound ycjF protein requires specific methodologies designed for integral membrane proteins:

  • Membrane Fraction Preparation:

    • Cultures should be grown in LB medium at 37°C to optimal density (OD600 ~0.6)

    • After induction with IPTG, expression can be conducted at either 18°C or 37°C depending on yield requirements

    • Membrane fractions are isolated through differential centrifugation as described by Kefala et al. (2007)

  • Detergent-Based Extraction:

    • Mix membrane fractions 1:1 with extraction buffer (20 mM Tris-HCl pH 7.6, 200 mM NaCl, 1 mM MgCl₂, 1 mM BME)

    • Use appropriate detergent concentrations above the critical protein solubilization concentration (CPSC)

    • For ycjF, detergents like DDM (n-dodecyl β-D-maltoside) and DM (n-decyl β-D-maltoside) are effective at concentrations between 4-6 mM

    • Incubate with gentle stirring overnight at 6°C to maximize protein extraction

  • Purification Protocol:

    • Centrifuge at 100,000 g for 1 hour to separate solubilized protein from insoluble material

    • Purify using affinity chromatography if a tag is present on the recombinant protein

    • Further purification can be achieved through size exclusion chromatography to obtain homogeneous protein samples

The extraction efficiency should be assessed using SDS-PAGE by comparing fractions before and after high-speed centrifugation .

What expression systems and vectors are most effective for recombinant production of ycjF?

Based on research findings, the following expression systems and strategies have proven effective for recombinant production of membrane proteins like ycjF:

  • Expression Vectors:

    • pMIS vector system has been successfully used for E. coli receptor kinases and similar membrane proteins

    • pET vector systems with appropriate fusion tags can enhance expression and solubility

  • Host Strains:

    • E. coli BL21(DE3) is the most commonly used strain for recombinant protein expression

    • Specialized strains like Lemo21(DE3), which allow tunable expression through rhamnose induction, can optimize membrane protein production

  • Expression Tags and Fusion Partners:

    • N-terminal fusion tags can significantly improve membrane protein expression

    • GFP fusion constructs allow real-time monitoring of expression and proper folding

    • Predicted transmembrane helices of ycjF (residues 1-147) can be cloned into appropriate vectors

  • Expression Conditions:

    • Induction at lower temperatures (18°C vs. 37°C) often results in better folding and less aggregation

    • Protein density in the membrane has been found to have the greatest influence on oligomeric structure

    • Expression conditions should be optimized considering maximum protein signal and homogeneity of cell populations

Research has demonstrated that expression strategies greatly impact the yield and quality of membrane proteins like ycjF, with proper tagging and expression conditions being critical factors for successful recombinant production.

What is the proposed function of ycjF in Salmonella pathogenesis?

While the precise function of ycjF in Salmonella pathogenesis remains to be fully elucidated, multiple lines of evidence suggest important roles:

  • Stress Response Involvement:

    • ycjF is upregulated during stress conditions and is associated with the phage shock protein (PSP) response

    • The gene shows altered expression patterns during heat shock, suggesting involvement in temperature stress adaptation

  • Genomic Context:

    • ycjF is closely associated with ycjX, which encodes a protein with a Ras-like GTP-binding domain

    • This genetic association suggests that ycjF may function as part of a signal transduction pathway in Salmonella

  • Strain Variation:

    • Comparative studies of Salmonella Heidelberg strains with different pathogenicity levels have revealed genomic and phenotypic differences

    • While not directly linked to ycjF in the provided literature, such variations highlight how membrane proteins can influence virulence

  • Transmembrane Signaling:

    • The close association between ycjX and ycjF suggests that ycjF may function as a transducer of transmembrane signals

    • This signaling function could potentially regulate virulence factors or stress responses in Salmonella

How does ycjF interact with other proteins in the bacterial membrane?

The interaction of ycjF with other membrane proteins involves complex mechanisms:

  • Association with YcjX:

    • ycjF has a close genetic association with ycjX, suggesting functional interaction between these proteins

    • YcjX contains a Ras-like GTP-binding domain and may function as a signal transducer that interacts with ycjF in the membrane

  • Protein-Detergent Complexes (PDCs):

    • Studies on membrane protein extraction have shown that detergents associate preferentially with integral membrane proteins (IMPs) like ycjF rather than with membrane lipids

    • This selective association impacts protein-protein interactions during extraction and purification

  • Oligomeric Structure:

    • Research on similar membrane proteins has demonstrated that protein density in the membrane significantly influences oligomeric structure

    • For ycjF, the conditions used for expression, which impact protein density in the membrane, likely have the greatest influence on its interactions with other proteins

  • Experimental Approaches:

    • Co-immunoprecipitation followed by mass spectrometry can identify interaction partners

    • Techniques like FRET (Fluorescence Resonance Energy Transfer) or BiFC (Bimolecular Fluorescence Complementation) can be used to study protein-protein interactions in the membrane environment

Understanding these interactions is crucial for elucidating the functional role of ycjF in bacterial physiology and potentially in pathogenesis.

How can CRISPR-Cas technologies be applied to study ycjF function in Salmonella?

CRISPR-Cas technologies offer powerful approaches for investigating ycjF function in Salmonella:

  • Gene Knockout Studies:

    • CRISPR-Cas9 can be used to create precise ycjF deletion mutants in Salmonella Heidelberg

    • Comparing the phenotypes of wild-type and ΔycjF strains under various conditions (stress, infection models) can reveal functional roles

    • Patent WO2019067621A1 describes CRISPR genetic systems that can be adapted to target and eliminate specific bacteria or sensitize them to antibiotics

  • Transcriptional Regulation:

    • CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) can be employed to modulate ycjF expression without genetic modification

    • This approach allows for controlled downregulation to study dose-dependent effects of ycjF on bacterial physiology

  • Domain Function Analysis:

    • CRISPR-based precise editing can introduce specific mutations in functional domains of ycjF

    • For example, mutations can target the predicted transmembrane regions (residues 1-147) to assess their importance in protein function

  • Genomic Tagging:

    • CRISPR-mediated homology-directed repair can be used to introduce fluorescent tags or affinity tags at the endogenous ycjF locus

    • This enables real-time monitoring of protein localization, expression dynamics, and purification of native protein complexes

  • Experimental Design Considerations:

    • Control experiments should include targeting unrelated genes to rule out off-target effects

    • Complementation studies with wild-type ycjF should be performed to confirm phenotypes are specifically due to ycjF mutation

    • Multiple guide RNAs should be designed and tested to ensure efficient targeting

CRISPR-based approaches provide precise genetic manipulation capabilities that can significantly advance our understanding of ycjF function in Salmonella pathogenesis and physiology.

What are the current challenges in structural characterization of ycjF and how can they be addressed?

Structural characterization of membrane proteins like ycjF faces several challenges:

  • Challenges in Crystallization:

    • Membrane proteins are notoriously difficult to crystallize due to their hydrophobic nature

    • The presence of detergents necessary for solubilization often interferes with crystal formation

    • The dynamic nature of transmembrane regions further complicates structural studies

  • NMR Spectroscopy Limitations:

    • Traditional solution NMR is limited by the size of protein-detergent complexes (PDCs)

    • For PDCs smaller than 30 kDa, stirred concentration cells are more effective than centrifugal ultrafiltration devices for sample preparation

    • Over-concentration of detergent can occur during sample preparation, affecting spectral quality

  • Advanced Methodological Solutions:

    • Cryo-EM Approaches: Single-particle cryo-electron microscopy can overcome many limitations of crystallography for membrane proteins

    • Hybrid Methods: Combining computational modeling with limited experimental data from cross-linking mass spectrometry

    • Lipid Nanodiscs: Reconstituting ycjF into nanodiscs provides a more native-like membrane environment for structural studies

    • X-ray Free Electron Laser (XFEL): Microcrystals of membrane proteins can be analyzed using serial femtosecond crystallography

  • Expression Optimization Strategies:

    • Creating fusion constructs with crystallization chaperones like T4 lysozyme or BRIL

    • Testing different detergents for optimal protein stability and homogeneity

    • Using thermostabilizing mutations identified through alanine scanning

  • Computational Approaches:

    • AlphaFold2 and RoseTTAFold can provide initial structural models

    • Molecular dynamics simulations can help understand dynamic behavior in membrane environments

    • These computational predictions should be validated with experimental data

Addressing these challenges requires integrative approaches combining advanced expression systems, novel purification strategies, state-of-the-art structural biology techniques, and computational methods.

How does ycjF from Salmonella heidelberg compare with homologous proteins in other bacterial species?

Comparative analysis of ycjF across bacterial species reveals important evolutionary and functional insights:

Understanding these comparative aspects provides valuable context for interpreting experimental results and developing hypotheses about ycjF function.

What role does ycjF play in antimicrobial resistance in Salmonella Heidelberg?

While direct evidence linking ycjF to antimicrobial resistance is limited in the provided literature, several connections can be made:

  • Association with Stress Responses:

    • ycjF is upregulated during stress conditions and is associated with the phage shock protein (PSP) response

    • Stress response systems often contribute to bacterial survival during antibiotic exposure

  • Membrane Protein Relevance:

    • As a membrane protein, ycjF could potentially influence membrane permeability or efflux pump function

    • Alterations in membrane proteins can affect drug uptake and contribute to resistance mechanisms

  • Outbreak Strain Characteristics:

    • Salmonella Heidelberg outbreak strains have shown resistance to antimicrobials such as trimethoprim/sulfamethoxazole

    • Though not directly linked to ycjF in the literature, genomic and phenotypic comparisons of Salmonella Heidelberg strains with different pathogenicity levels have revealed significant differences

  • Research Approaches:

    • To investigate potential roles of ycjF in antimicrobial resistance, researchers could:

      • Create ycjF knockout strains and test their susceptibility to various antibiotics

      • Examine ycjF expression levels in resistant versus susceptible isolates

      • Investigate whether ycjF overexpression affects minimum inhibitory concentrations (MICs)

      • Use antimicrobial susceptibility testing methods like the Sensititre™ National Antimicrobial Resistance Monitoring System panel

  • Potential Mechanisms:

    • If involved in resistance, ycjF might contribute through:

      • Altering membrane characteristics that affect drug penetration

      • Participating in stress-response pathways that enhance bacterial survival

      • Interacting with known resistance determinants or transporters

Further research specifically targeting the relationship between ycjF and antimicrobial resistance is needed to clarify these potential connections.

How can recombinant ycjF be utilized in vaccine development against Salmonella Heidelberg?

Recombinant ycjF protein offers several potential applications for vaccine development against Salmonella Heidelberg:

  • Antigenic Potential Assessment:

    • The antigenicity of membrane proteins can be analyzed using bioinformatics tools like VaxiJen (version 2.0)

    • Allergenicity prediction using AllerTOP (version 2.0) and toxicity analysis with ToxinPred are important preliminary steps

    • These assessments help determine if ycjF contains suitable epitopes for vaccine development

  • Epitope Mapping Strategies:

    • Both in silico prediction and in vivo experimental approaches can identify immunogenic epitopes

    • Mass spectrometry in association with immunoprecipitation proteomics has successfully mapped epitopes in other Salmonella proteins like FlgK

    • Identified epitopes can be used to design subunit vaccines targeting specific regions of ycjF

  • Expression and Purification for Vaccine Studies:

    • Recombinant ycjF can be produced using optimized expression systems described in section 2.2

    • Purification methods must ensure the protein maintains proper conformation and epitope structures

    • Quality control should include tests for endotoxin contamination and protein homogeneity

  • Adjuvant Selection and Formulation:

    • Proper adjuvant selection is crucial for membrane protein-based vaccines

    • Previous studies with Salmonella proteins have successfully used Freund's incomplete adjuvant

    • Dose optimization studies should determine the appropriate amount of recombinant protein (typically around 100 μg per dose)

  • Evaluation in Animal Models:

    • Immunization protocols in broiler chickens have been established (primary immunization at one week of age, booster at three weeks)

    • Blood samples can be collected for serological analysis at five weeks post-immunization

    • Challenge studies with virulent Salmonella Heidelberg strains can assess protective efficacy

  • Delivery System Considerations:

    • Membrane proteins often benefit from delivery systems that preserve their structure

    • Liposomes, nanoparticles, or virus-like particles may enhance immunogenicity of ycjF-based vaccines

    • Mucosal delivery systems may be particularly relevant for Salmonella vaccines

These approaches provide a framework for exploring the potential of recombinant ycjF in developing vaccines against Salmonella Heidelberg infections.

What new research directions should be prioritized to better understand ycjF function in bacterial physiology?

To advance our understanding of ycjF function in bacterial physiology, several research directions should be prioritized:

  • Comprehensive Interaction Network Mapping:

    • Apply proximity-labeling techniques (BioID, APEX) to identify proteins that interact with ycjF in vivo

    • Perform systematic co-immunoprecipitation studies coupled with mass spectrometry

    • Investigate the functional relationship between ycjF and ycjX, which appears to be a GTPase with a Ras-like domain

  • High-Resolution Structural Studies:

    • Determine the three-dimensional structure of ycjF using cryo-EM or X-ray crystallography

    • Perform molecular dynamics simulations to understand conformational changes in different membrane environments

    • Identify key structural domains that mediate protein-protein interactions

  • Systematic Functional Genomics:

    • Create a comprehensive set of point mutations targeting conserved residues

    • Perform Tn-seq analysis under various stress conditions to identify genetic interactions

    • Develop inducible expression systems to study dose-dependent effects of ycjF

  • Transcriptional Regulation Mechanisms:

    • Identify transcription factors that regulate ycjF expression using ChIP-seq

    • Characterize the promoter region and regulatory elements using reporter assays

    • Investigate post-transcriptional regulation mechanisms, including potential small RNA interactions

  • Comparative Systems Biology:

    • Compare the role of ycjF across multiple Salmonella serovars with varying virulence profiles

    • Investigate potential differential expression in antibiotic-resistant versus susceptible isolates

    • Perform comparative proteomics between wild-type and ycjF mutant strains under different stress conditions

  • Host-Pathogen Interaction Studies:

    • Examine the impact of ycjF on Salmonella survival within host cells

    • Investigate whether ycjF affects the host immune response during infection

    • Determine if ycjF influences bacterial persistence in different host tissues

  • Translational Research Applications:

    • Explore ycjF as a potential drug target, particularly if it proves essential for stress survival

    • Develop high-throughput screening assays to identify inhibitors of ycjF function

    • Evaluate whether antibodies against ycjF could provide passive protection against infection

These research directions would significantly advance our understanding of ycjF's role in bacterial physiology and potentially lead to new strategies for controlling Salmonella infections.

What are common challenges in expression and purification of ycjF, and how can they be addressed?

Researchers frequently encounter several challenges when working with membrane proteins like ycjF:

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in standard systems

    • Solutions:

      • Use specialized expression vectors with strong but regulatable promoters

      • Test multiple fusion tags (N-terminal vs C-terminal positioning)

      • Evaluate different E. coli strains (BL21, C41/C43, Lemo21)

      • Optimize induction conditions (temperature, inducer concentration, time)

      • Consider codon optimization for the expression host

  • Protein Aggregation:

    • Challenge: Membrane proteins tend to aggregate during overexpression

    • Solutions:

      • Lower expression temperature (18°C vs 37°C) to slow folding

      • Use slower induction methods (auto-induction media or lower IPTG concentrations)

      • Add stabilizing agents (glycerol, specific salts) to growth media

      • Co-express with molecular chaperones

  • Inefficient Membrane Extraction:

    • Challenge: Incomplete solubilization from membranes

    • Solutions:

      • Determine the critical protein solubilization concentration (CPSC) for chosen detergents

      • For ycjF, DDM and DM are effective at concentrations between 4-6 mM

      • Extend extraction time (overnight at 6°C with gentle stirring)

      • Test multiple detergent types and combinations

  • Protein Instability After Purification:

    • Challenge: Loss of structural integrity during storage

    • Solutions:

      • Store at -20°C in 50% glycerol for extended storage

      • Use working aliquots at 4°C for up to one week

      • Avoid repeated freeze-thaw cycles

      • Include stabilizing agents in storage buffers

  • Detergent Interference with Downstream Applications:

    • Challenge: Excess detergent affecting assays or structural studies

    • Solutions:

      • Use stirred concentration cells rather than centrifugal devices for PDCs smaller than 30 kDa

      • Consider detergent exchange to more compatible alternatives

      • Test detergent removal methods (Bio-Beads, cyclodextrin) when appropriate

  • Troubleshooting Guide:

    IssueDiagnostic ApproachSolution
    No visible expressionSDS-PAGE, Western blotChange expression strain, adjust induction parameters
    Expression but no solubilizationCompare pre/post centrifugation fractionsIncrease detergent concentration above CPSC
    Protein aggregation after purificationSize exclusion chromatographyOptimize buffer conditions, add stabilizing agents
    Loss of activityFunctional assaysMaintain critical lipids, test gentler purification methods

Implementing these strategies can significantly improve the yield and quality of recombinant ycjF protein for research applications.

How can researchers effectively design experiments to investigate ycjF function when genomic data is contradictory?

When facing contradictory genomic data about ycjF function, researchers should employ a systematic experimental design approach:

  • Triangulation Through Multiple Methods:

    • Strategy: Use complementary approaches to test the same hypothesis

    • Implementation:

      • Combine gene knockout studies with complementation experiments

      • Support phenotypic observations with transcriptomic and proteomic data

      • Verify key findings using independent experimental techniques

  • Strain Variation Analysis:

    • Challenge: Different Salmonella Heidelberg strains show genomic and phenotypic variations

    • Approach:

      • Characterize ycjF sequence and expression across multiple strains

      • Test hypotheses in diverse strain backgrounds

      • Document strain-specific differences systematically

      • Example: Studies have shown strains with PFGE patterns JF6X01.0523 (highly pathogenic) versus JF6X01.0590 (less pathogenic) have significant differences

  • Controlled Environmental Conditions:

    • Strategy: Test function across varied conditions that might reveal context-dependent roles

    • Design Elements:

      • Examine ycjF expression and mutant phenotypes under specific stress conditions

      • Include relevant in vivo models that mimic infection environments

      • Control for growth phase, media composition, and temperature

  • Statistical Rigor and Sample Size:

    • Approach: Design experiments with appropriate statistical power

    • Implementation:

      • Conduct multiple biological replicates (minimum 3-5)

      • Perform technical replicates within each biological replicate

      • Apply appropriate statistical tests (t-test for simple comparisons, ANOVA for multiple conditions)

      • Consider significance thresholds and corrections for multiple testing

  • Systematic Controls:

    • Strategy: Include comprehensive controls for all experimental variables

    • Examples:

      • Wild-type strain grown under identical conditions

      • Complemented mutant strains to confirm phenotype specificity

      • Unrelated gene mutations to control for general stress effects

      • Empty vector controls for expression studies

  • Data Integration Framework:

    • Challenge: Contradictory data may arise from different experimental contexts

    • Solution:

      • Create an integrated analysis pipeline that combines:

        • Transcriptomic data showing expression patterns

        • Proteomic data revealing protein levels and modifications

        • Phenotypic assays under standardized conditions

        • Interaction studies to identify functional partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.