Recombinant Salmonella heidelberg UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Genetic Conservation & Homology

The yjjB gene is conserved across multiple Salmonella serovars and E. coli, as evidenced by recombinant variants produced for:

  • Salmonella Schwarzengrund (UniProt: B4TU22)

  • Salmonella Dublin (Locus: SeD_A4959)

  • Salmonella Arizona (UniProt: A9MRX4)

  • E. coli O157:H7

Comparative sequence analysis reveals >95% amino acid identity among these variants, suggesting a critical but poorly characterized biological role .

Functional Annotation

While the exact function of YjjB remains unconfirmed, its classification as a UPF0442 family protein implies involvement in:

  • Membrane-associated processes (predicted transmembrane domains)

  • Hypothetical stress response pathways (common in Salmonella virulence)

  • Bacterial persistence mechanisms (linked to antibiotic tolerance in Salmonella Heidelberg)

Notably, YjjB is distinct from flagellar proteins like FlgK or FliD, which are validated immunogens in poultry vaccines .

Antimicrobial Resistance Studies

  • Salmonella Heidelberg frequently carries multidrug resistance (MDR) plasmids (e.g., bla<sub>CMY-2</sub>, bla<sub>TEM-1</sub>) .

  • Recombinant YjjB enables structural studies to identify binding sites for novel β-lactamase inhibitors .

Vaccine Development

  • Though not directly tested as an antigen, YjjB’s surface exposure in Salmonella makes it a candidate for epitope mapping (similar to FlgK in ).

  • Subunit vaccines using recombinant proteins (e.g., FliD, FlgK) show promise in reducing poultry colonization .

Pathogenicity Mechanisms

  • Genomic studies link yjjB to hypervirulent Salmonella Heidelberg strains causing bovine septicemia .

  • Strains with upregulated fimbriae/flagella genes (e.g., SX 245) exhibit enhanced epithelial invasion, suggesting YjjB may modulate host interactions .

Comparative Analysis of Recombinant YjjB Variants

SpeciesHost SystemPurityKey Use Case
S. Heidelberg E. coli>90%Pathogenesis & structural studies
S. Schwarzengrund E. coli>85%Cross-serovar antibody production
S. Arizona E. coli>85%Conservation analysis
E. coli O157:H7 Cell-free expression>85%Comparative genomics

Challenges & Future Directions

  • Functional Characterization: No direct evidence yet links YjjB to specific metabolic or virulence pathways .

  • Immunogenicity: Unlike flagellar proteins (e.g., FlgK), YjjB lacks confirmed antigenic epitopes in poultry .

  • Therapeutic Potential: Requires structural studies to assess druggability in MDR Salmonella .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjjB; SeHA_C4953; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant yjjB protein samples?

For recombinant yjjB protein, implementing proper storage protocols is crucial for maintaining sample integrity and experimental reproducibility. The recommended storage conditions are:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Medium-term storage: Store at -20°C

  • Long-term storage: Store at -20°C or preferably -80°C for extended preservation

When working with this protein, it is important to avoid repeated freeze-thaw cycles as this significantly degrades protein structure and activity . Best practice involves dividing the stock solution into smaller single-use aliquots immediately upon receipt. For lyophilized preparations, reconstitute only the amount needed for immediate experiments and store the remainder as a lyophilized powder when possible.

How does yjjB protein relate to Salmonella pathogenicity and virulence mechanisms?

While yjjB itself is not identified as a primary virulence factor, it exists within the genomic context of Salmonella heidelberg, which possesses multiple pathogenicity islands and virulence genes. Salmonella heidelberg contains at least ten Salmonella Pathogenicity Islands (SPI1, SPI2, SPI3, SPI4, SPI5, SPI9, SPI11, SPI12, SPI13, and SPI14) that contribute to its virulence profile .

The virulence capabilities of Salmonella heidelberg include approximately 139 identified virulence genes, with 95 genes consistently present across isolates . These include important operons such as:

  • cheWY - involved in chemotaxis

  • csgABCDEFG - curli production

  • fimCDFHI - fimbrial assembly

  • lpfABCDE - long polar fimbriae

  • ssaCDEGHIJKLMNOPQRSTUV and sseABCDEFGJKL - Type III secretion system components

Understanding the functional relationship between yjjB and these virulence mechanisms requires targeted experimental approaches such as knockout studies or protein-protein interaction analyses to determine if yjjB plays a supporting role in pathogenicity.

What experimental approaches are optimal for expressing recombinant Salmonella heidelberg yjjB protein with high yield and purity?

Achieving high-yield, high-purity recombinant yjjB protein requires optimization of several experimental parameters. Based on established protocols, the following methodological approach is recommended:

Expression System Selection:
Multiple expression systems have been validated for yjjB expression, including E. coli, yeast, baculovirus, and mammalian cell systems . For membrane proteins like yjjB, the E. coli system typically offers the best balance of yield and cost-effectiveness, though mammalian systems may provide more native-like post-translational modifications.

Expression Vector Design:

  • Include an appropriate tag (N-terminal or C-terminal) to facilitate purification

  • Consider codon optimization for the expression host

  • Incorporate a TEV protease cleavage site for tag removal if needed for functional studies

Expression Protocol:

  • Transform expression vector into appropriate host cells

  • Culture in rich media (e.g., 2xYT, TB) at optimal temperature (typically 18-30°C for membrane proteins)

  • Induce with appropriate inducer at mid-log phase (OD600 ~0.6-0.8)

  • Extend expression time (12-16 hours) at reduced temperature (18-25°C) to enhance proper folding

Purification Strategy:

  • Cell lysis using detergent cocktails optimized for membrane proteins

  • Affinity chromatography using the incorporated tag

  • Size exclusion chromatography for final polishing

  • Verify purity via SDS-PAGE (target ≥85% purity)

This methodology typically yields purified recombinant yjjB protein suitable for downstream structural and functional characterization studies.

How do sequence variations in yjjB across different Salmonella heidelberg strains correlate with antibiotic resistance profiles?

Sequence analysis of yjjB across different Salmonella heidelberg strains reveals interesting correlations with antibiotic resistance patterns. Multidrug-resistant (MDR) S. heidelberg has become increasingly prevalent in both poultry and cattle settings, with distinct genomic characteristics .

When examining sequence variations in yjjB, researchers should consider:

  • Single Nucleotide Polymorphisms (SNPs): Specific SNPs within the yjjB gene may correlate with resistance to particular antibiotic classes. Whole genome sequencing (WGS) approaches have revealed that closely related S. heidelberg isolates can harbor distinct resistance profiles .

  • Genomic Context Analysis: Evaluate the proximity of yjjB to mobile genetic elements that may carry resistance genes. The chromosomal location of yjjB (NC_002655.2) should be examined in relation to identified resistance islands.

  • Comparative Genomics Approach:

    • Compare yjjB sequences from isolates with known resistance profiles

    • Conduct phylogenetic analysis to identify evolutionary relationships

    • Utilize statistical methods to determine significant associations between sequence variants and resistance patterns

  • Isolate collection from diverse sources (clinical, agricultural, environmental)

  • Whole genome sequencing of isolates

  • Antibiotic susceptibility testing using standardized methods

  • Bioinformatic analysis to correlate yjjB sequences with resistance profiles

  • Functional validation through gene knockout or complementation studies

This approach can reveal whether yjjB variants contribute directly or indirectly to the multidrug resistance phenotypes observed in emerging S. heidelberg strains.

What structural prediction methods are most accurate for determining the membrane topology of yjjB protein?

As a multi-pass membrane protein , determining the accurate membrane topology of yjjB requires combining computational prediction with experimental validation approaches. The following methodological framework represents current best practices:

Computational Prediction Methods:

  • Hydropathy Analysis: Apply algorithms such as Kyte-Doolittle or Eisenberg scales to identify potential transmembrane regions based on hydrophobicity patterns.

  • Machine Learning Approaches: Utilize advanced predictors like TMHMM, HMMTOP, or Phobius that apply hidden Markov models to predict transmembrane helices.

  • Consensus Method Applications: Combine multiple prediction tools (TOPCONS, CCTOP) to generate consensus topology models, which typically achieve higher accuracy than single predictions.

  • Evolutionary Conservation Analysis: Apply tools like ConSurf to identify conserved residues across the UPF0442 family, often indicating functional importance.

Experimental Validation Methods:

  • Cysteine Scanning Mutagenesis: Systematically replace residues with cysteine and test accessibility to membrane-impermeable reagents.

  • Reporter Fusion Techniques: Create fusion proteins with reporters like GFP or alkaline phosphatase at various positions to determine cellular localization.

  • Protease Protection Assays: Limited proteolysis combined with mass spectrometry to identify exposed versus protected regions.

  • Cryo-EM or X-ray Crystallography: For definitive structural determination, though challenging for membrane proteins.

The ideal approach involves iterative refinement, where computational predictions guide initial experimental designs, and experimental results inform improved computational models. For yjjB specifically, combining hydropathy analysis with evolutionary conservation patterns has shown good predictive value for related proteins in the UPF0442 family.

How does yjjB expression change during Salmonella infection cycles and what experimental models best capture these dynamics?

Understanding the expression dynamics of yjjB during infection requires appropriate experimental models and detection techniques. The following methodological approach allows researchers to effectively monitor yjjB expression throughout infection cycles:

Cell Culture Models:

  • Intestinal Epithelial Cells: Caco-2 or HT-29 cell lines provide models for initial invasion

  • Macrophage Models: RAW264.7 or THP-1 cells to study intracellular survival

  • 3D Organoid Systems: Intestinal organoids offer more physiologically relevant conditions

Animal Models:

  • Mouse Models: For systemic infection studies

  • Bovine Models: Particularly relevant given the 2015-2017 outbreak in cattle

  • Poultry Models: Aligned with the predominant reservoir for S. heidelberg

Expression Monitoring Techniques:

  • RT-qPCR: For sensitive quantification of yjjB transcript levels

  • RNA-Seq: For genome-wide expression context

  • Reporter Strains: GFP or luciferase fusions to the yjjB promoter

  • Proteomics: MS-based approaches to detect protein levels

Time-Course Experimental Design:
A comprehensive approach involves collecting samples at multiple timepoints:

  • Early attachment (0-30 minutes)

  • Invasion (1-2 hours)

  • Intracellular adaptation (4-8 hours)

  • Persistence phase (24-48 hours)

This allows for correlation of yjjB expression with different stages of the infection cycle. Data from such experiments can be analyzed to determine if yjjB shows expression patterns consistent with:

  • Constitutive expression (housekeeping function)

  • Stress-induced expression (adaptation to host environment)

  • Virulence-associated expression (coordinated with known virulence factors)

Understanding these dynamics provides insights into the potential functional role of yjjB in Salmonella pathogenesis.

What analytical techniques provide the most accurate characterization of yjjB protein-membrane interactions?

Characterizing the interactions between yjjB protein and cellular membranes requires specialized techniques that can probe membrane protein behavior in native-like environments. The following methodological approaches provide complementary information:

Biophysical Techniques:

  • Fluorescence Spectroscopy: Using environment-sensitive probes to measure insertion depth and orientation

  • FRET Analysis: To measure distances between specific residues and membrane components

  • Surface Plasmon Resonance (SPR): For measuring binding kinetics to membrane components

  • Differential Scanning Calorimetry: To determine thermal stability within membranes

Structural Biology Approaches:

  • Nuclear Magnetic Resonance (NMR): Solution NMR with detergent micelles or solid-state NMR with lipid bilayers

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To identify membrane-protected regions

  • Site-Directed Spin Labeling EPR: For determining topological arrangement in membranes

Model Membrane Systems:

  • Liposomes: Simple vesicular systems with defined lipid composition

  • Nanodiscs: Disc-shaped lipid bilayers stabilized by scaffold proteins

  • Lipid Cubic Phases: For crystallization trials of membrane proteins

When specifically studying yjjB, researchers should consider:

  • Using lipid compositions that mimic the Salmonella inner membrane

  • Comparing results across multiple technique platforms

  • Including appropriate controls with known membrane topology

Data analysis should integrate results from multiple techniques to develop a comprehensive model of yjjB-membrane interactions, which is essential for understanding its function in the context of Salmonella pathogenicity.

How can researchers effectively design knockout and complementation studies to determine the functional role of yjjB in Salmonella heidelberg?

Designing rigorous knockout and complementation studies for yjjB requires careful planning to ensure reliable phenotypic analysis. The following methodological framework outlines best practices:

Knockout Strategy:

  • Precise Gene Deletion: Use lambda-Red recombineering or CRISPR-Cas9 systems to create clean deletions without polar effects on adjacent genes

  • Marker Selection: Consider using antibiotic resistance cassettes flanked by FRT sites for subsequent removal

  • Verification Methods:

    • PCR confirmation of deletion

    • Whole genome sequencing to confirm absence of unwanted mutations

    • RT-PCR to verify absence of yjjB transcription

Complementation Approach:

  • Expression Vector Selection: Use low-copy plasmids with native or inducible promoters

  • Construct Design Options:

    • Native yjjB gene without modifications

    • C-terminal tagged versions for detection

    • Point mutants for structure-function analysis

  • Expression Level Control: Titrate expression to physiological levels to avoid artifacts

Phenotypic Analysis:

  • Growth Characteristics:

    • Growth curves in standard and stress conditions

    • Competitive index in mixed cultures

  • Virulence-Related Phenotypes:

    • Invasion assays in epithelial cell models

    • Survival in macrophage models

    • Biofilm formation capacity

  • Membrane-Related Functions:

    • Membrane integrity assays

    • Permeability to various compounds

    • Resistance to membrane-targeting antibiotics

Advanced Analytical Methods:

  • Transcriptomics: RNA-Seq to identify genes affected by yjjB deletion

  • Proteomics: Quantitative proteomics to detect changes in protein abundance

  • Metabolomics: To identify metabolic pathways affected by yjjB deletion

This comprehensive approach allows researchers to distinguish direct effects of yjjB deletion from compensatory responses, providing insights into the functional role of this protein in Salmonella heidelberg biology and pathogenesis.

What are the most reliable methods for studying potential protein-protein interactions involving yjjB?

Investigating protein-protein interactions (PPIs) involving membrane proteins like yjjB requires specialized approaches that accommodate their hydrophobic nature. The following methodological framework provides a systematic approach:

In Vivo Techniques:

  • Bacterial Two-Hybrid (BACTH): Modified for membrane proteins by using split adenylate cyclase fragments

    • Advantages: Works in bacterial systems, detects interactions in native membrane

    • Limitations: May generate false positives, requires careful controls

  • Split-GFP Complementation: Fusion of protein partners with non-fluorescent GFP fragments

    • Advantages: Visualizes interaction location within cells

    • Limitations: May affect protein folding or function

  • In Vivo Crosslinking: Using photo-activatable or chemical crosslinkers

    • Advantages: Captures transient interactions

    • Limitations: Requires optimization of crosslinking conditions

In Vitro Approaches:

  • Co-Immunoprecipitation with Membrane-Compatible Detergents:

    • Critical parameters: Detergent selection, salt concentration, buffer composition

    • Validation: Mass spectrometry identification of co-precipitated proteins

  • Pull-Down Assays with Purified Components:

    • Using tagged recombinant yjjB as bait

    • Requires careful selection of tag position to avoid interference with interactions

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • For measuring binding kinetics between yjjB and candidate interactors

    • Requires immobilization strategies compatible with membrane proteins

Advanced Methods:

  • Proximity-Dependent Biotin Identification (BioID):

    • Fusion of biotin ligase to yjjB to biotinylate proximal proteins

    • Advantages: Identifies weak or transient interaction partners

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Identifies interaction interfaces through differential solvent accessibility

    • Particularly useful for mapping interaction sites

When applying these methods to yjjB research, consider:

  • Starting with unbiased screening approaches to identify candidate interactors

  • Following up with targeted methods to validate specific interactions

  • Using multiple complementary approaches to build confidence in results

  • Including appropriate negative controls (unrelated membrane proteins)

The combination of multiple techniques provides the most reliable assessment of protein-protein interactions involving membrane proteins like yjjB.

How might yjjB function relate to multidrug resistance mechanisms in emerging Salmonella heidelberg strains?

The relationship between yjjB and multidrug resistance (MDR) in Salmonella heidelberg represents an important emerging research direction. While yjjB is not directly identified as a resistance determinant, its membrane localization suggests potential involvement in membrane permeability or transport processes that could influence antibiotic susceptibility.

Recent outbreaks of MDR Salmonella heidelberg, including the 2015-2017 outbreak linked to dairy beef calves , highlight the clinical importance of understanding all factors contributing to resistance. Research approaches to explore the potential role of yjjB in resistance include:

Comparative Genomics Analysis:

  • Compare yjjB sequences between susceptible and resistant isolates

  • Identify co-occurrence patterns between yjjB variants and known resistance genes

  • Analyze the genomic neighborhood of yjjB for evidence of horizontal gene transfer events

Experimental Approaches:

  • Susceptibility Testing: Compare minimum inhibitory concentrations (MICs) between wild-type and yjjB knockout strains

  • Membrane Permeability Assays: Measure uptake of fluorescent dyes or labeled antibiotics

  • Efflux Inhibition Studies: Determine if yjjB deletion affects the activity of efflux pump inhibitors

Proposed Mechanisms to Investigate:

  • yjjB as a minor facilitator or modulator of known efflux systems

  • yjjB involvement in membrane stress responses that indirectly affect resistance

  • yjjB interaction with regulatory networks controlling resistance gene expression

This research direction has significant implications for understanding the evolution of antibiotic resistance in Salmonella heidelberg and may identify novel targets for interventions to combat MDR strains.

What computational models best predict the functional impacts of yjjB mutations on Salmonella heidelberg virulence?

Predicting how mutations in yjjB affect Salmonella heidelberg virulence requires sophisticated computational approaches that integrate structural, evolutionary, and systems biology perspectives. The following methodological framework represents current best practices:

Sequence-Based Prediction Models:

  • Evolutionary Conservation Analysis:

    • Multiple sequence alignments across the UPF0442 family

    • Identification of highly conserved residues likely critical for function

    • Tools: ConSurf, Evolutionary Trace, SIFT

  • Machine Learning Approaches:

    • Support Vector Machines (SVMs) trained on known virulence factor mutations

    • Random Forest models incorporating sequence and structural features

    • Deep learning methods integrating multiple data types

Structure-Based Prediction Methods:

  • Homology Modeling: Generate 3D structural models using related proteins as templates

  • Molecular Dynamics Simulations: Assess how mutations affect:

    • Protein stability in membrane environments

    • Conformational dynamics

    • Interaction with lipids and potential protein partners

  • Binding Site Prediction: Identify potential functional sites using tools like FTSite or CASTp

Systems Biology Integration:

  • Network Analysis: Position yjjB within protein-protein interaction networks

  • Pathway Impact Prediction: Assess how yjjB mutations might affect virulence-associated pathways

  • Gene Regulatory Network Models: Predict effects on transcriptional programs

Validation Framework:
To develop reliable prediction models, researchers should:

  • Create a training dataset of experimentally characterized yjjB mutations

  • Perform cross-validation using known phenotypes

  • Test model predictions with targeted experimental studies

  • Refine models based on experimental feedback

This integrative computational approach can guide experimental efforts by prioritizing mutations for functional studies and providing mechanistic hypotheses for how specific yjjB variants might affect Salmonella heidelberg virulence.

What are the key unanswered questions about yjjB that represent the most promising research opportunities?

Despite the growing body of knowledge about Salmonella heidelberg and its proteins, several critical questions about yjjB remain unanswered, representing significant research opportunities:

  • Fundamental Function: The precise biological function of yjjB remains unclear. As a member of the UPF0442 family , its role in Salmonella physiology, metabolism, or virulence needs definitive characterization.

  • Regulation Mechanisms: The conditions that regulate yjjB expression during infection cycles or environmental stress are poorly understood. Identifying the transcriptional and post-transcriptional regulatory mechanisms would provide insights into when and why the protein is needed.

  • Structural Determinants: While computational models can predict membrane topology, high-resolution structural data for yjjB is lacking. Determining the structure would enable structure-based drug design targeting this protein if it proves important for virulence.

  • Host-Pathogen Interface: Whether yjjB interacts with host factors during infection remains unexplored. Identifying potential host targets could reveal novel aspects of Salmonella pathogenesis.

  • Evolution and Adaptation: How yjjB variants contribute to the remarkable adaptability of Salmonella heidelberg across diverse hosts (poultry, cattle, humans) represents an important evolutionary question with practical implications for controlling transmission.

These research opportunities are particularly relevant given the public health significance of Salmonella heidelberg as a foodborne pathogen frequently associated with multidrug resistance . Addressing these questions requires interdisciplinary approaches combining structural biology, genetics, systems biology, and infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.