Recombinant Salmonella heidelberg UPF0756 membrane protein YeaL (yeaL)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant YeaL is produced under optimized conditions:

  • Expression System: E. coli

  • Purification Method: Affinity chromatography using His-tag

  • Reconstitution: Lyophilized powder reconstituted in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

  • Storage: Lyophilized form stable for 12 months at -80°C; liquid form stable for 6 months at -20°C

4.1. Vaccine Development

OMPs are promising vaccine candidates due to their surface exposure and antigenicity. For instance:

  • S. Typhi OMPs induce protective immunity in murine models .

  • Recombinant YeaL could serve as a component of subunit vaccines targeting S. Heidelberg, a serovar linked to foodborne outbreaks .

4.2. Antimicrobial Resistance (AMR) Studies

S. Heidelberg strains carrying plasmids with AMR genes (e.g., blaOXA-48 for carbapenem resistance) highlight the need for novel therapeutic targets like YeaL .

Comparative Analysis Across Serovars

YeaL is highly conserved in Salmonella:

SerovarUniProt IDStrainSequence Identity
S. HeidelbergB4TFR0SL476100% (reference)
S. DublinB5FJH1CT_0202185399.3%
S. Paratyphi BA9N2A7ATCC 9150 / SARB4298.9%
S. TyphiQ8Z6E5CT18/Ty297.6%

Data from

Research Gaps and Future Directions

  • Mechanistic Studies: The exact role of YeaL in membrane dynamics or virulence requires further investigation.

  • In Vivo Models: Efficacy testing of YeaL-based vaccines in animal models is needed.

  • Structural Biology: High-resolution structures of YeaL could clarify its interactions with host immune components .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yeaL; SeHA_C1406; UPF0756 membrane protein YeaL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yeaL
Target Protein Sequence
MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLNTFFPWIEKQGLTVGIIILTI GVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQPQLVAGLLVGT VLGVALFRGVPVGPLIAAGLVSLIVGKQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0756 membrane protein YeaL and its significance in Salmonella heidelberg?

The UPF0756 membrane protein YeaL is a 148-amino acid transmembrane protein initially characterized in Escherichia coli, with homologous proteins found in Salmonella species including S. heidelberg . While its precise function remains under investigation, researchers have identified it as a potential contributor to bacterial membrane integrity and possibly antibiotic resistance mechanisms.

To study this protein, researchers typically employ recombinant DNA technology to express the yeaL gene in controlled systems. The methodological approach involves:

  • Gene amplification using PCR with primers specific to the yeaL sequence

  • Cloning into expression vectors with appropriate promoters and affinity tags

  • Transformation into expression hosts (typically E. coli)

  • Induction of protein expression and subsequent purification

Structural analysis through computational modeling techniques has provided insights into YeaL's potential functional domains, with a global confidence score (pLDDT) of 84.87 indicating a relatively reliable structural prediction .

How does S. heidelberg differ from other Salmonella serovars in terms of antimicrobial resistance profiles?

S. heidelberg has emerged as a clinically significant serovar due to its distinctive antimicrobial resistance profile. Most clinical isolates (88%) demonstrate resistance or reduced susceptibility to antibiotics from five or more antibiotic classes, including first-line treatments for severe salmonellosis such as ampicillin, ceftriaxone, and ciprofloxacin .

The methodological approach to characterizing these resistance profiles includes:

  • Isolation and culture of S. heidelberg from clinical or environmental samples

  • Antimicrobial susceptibility testing using standardized methods (disc diffusion or broth microdilution)

  • Whole genome sequencing to identify resistance genes

  • PFGE (pulsed-field gel electrophoresis) pattern analysis to establish strain relationships

Historical context is important: S. heidelberg was first identified in 1933 following a human outbreak in Heidelberg, Germany, and has since been associated with multidrug-resistant outbreaks globally, including recent incidents linked to poultry and dairy cattle in the United States .

What experimental techniques are most effective for isolating and characterizing membrane proteins from S. heidelberg?

For researchers working with membrane proteins like YeaL from S. heidelberg, a systematic approach is essential:

  • Bacterial culture optimization:

    • Grow S. heidelberg under conditions that promote expression of the target protein

    • Consider induction methods if working with recombinant systems

  • Membrane fraction isolation:

    • Cell lysis by methods that preserve membrane integrity (sonication or French press)

    • Differential centrifugation to separate membrane fractions

    • Density gradient ultracentrifugation for further purification

  • Protein extraction and solubilization:

    • Selection of appropriate detergents (e.g., DDM, LDAO, or Triton X-100)

    • Optimization of detergent concentration and buffer conditions

    • Maintaining protein stability during solubilization

  • Purification strategies:

    • Affinity chromatography (if tagged recombinant protein)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Characterization techniques:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for protein identification

    • Circular dichroism for secondary structure analysis

    • Computational structure prediction models, which have shown confidence scores (pLDDT) of 84.87 for homologous YeaL proteins

How does the novel trimethoprim resistance gene dfrA34 in S. heidelberg function, and what is its relationship to membrane proteins?

The dfrA34 gene represents a novel mechanism of trimethoprim resistance in S. heidelberg, identified during a multistate outbreak investigation by the CDC in 2017 . This gene encodes a dihydrofolate reductase variant that shares less than 50% amino acid identity with previously reported dfrA variants.

The functional characterization methodology included:

  • Cloning the 588 bp putative dfr gene from S. heidelberg isolate 2016K-0796

  • Transforming it into E. coli

  • Measuring trimethoprim MIC values in resulting transformants (≥2 mg/L) compared to control strains with empty vectors (0.5 mg/L)

Notably, genomic analysis revealed that dfrA34 is invariably found alongside the sul1 gene, creating a genetic arrangement that confers clinical trimethoprim/sulfamethoxazole resistance . The genetic context includes a 5533 bp region containing dfrA34, ISCR1, and the 3′-CS (sul1).

While direct interactions between dfrA34 and membrane proteins like YeaL have not been definitively established, their potential relationship is of interest because:

  • Membrane proteins often influence drug efflux and cellular permeability

  • Genetic elements carrying resistance genes may co-localize with membrane protein-encoding regions

  • Mobile genetic elements containing resistance determinants can affect membrane protein expression

What role do plasmids play in antimicrobial resistance transfer in S. heidelberg, and how might this affect membrane protein expression?

Plasmids serve as critical vectors for antimicrobial resistance dissemination in S. heidelberg, with distinct implications for membrane protein expression and function. Research has identified several key plasmid types associated with resistance:

  • IncI1 plasmids harboring the bla<sub>CMY-2</sub> gene (conferring beta-lactam resistance)

  • IncC plasmids carrying multiple resistance genes including floR, cmlA1, tet(A), bla<sub>TEM-1B</sub>, ant(2′′)-Ia, aph(6)-Id, aph(3′′)-Ib, and sul2

  • Col plasmids, which may influence bacterial persistence in environmental conditions

A methodological investigation of plasmid dynamics demonstrated that:

  • S. heidelberg strains carrying higher copy numbers of small Col plasmids demonstrated enhanced survival in environmental conditions

  • Strains harboring transmissible plasmids with AmpC-like beta-lactamase genes persisted longer without antibiotic selection pressure

  • Mobile genetic elements, including plasmids and bacteriophages, played significant roles in S. heidelberg persistence

The potential influence on membrane proteins stems from the observation that:

  • Plasmid acquisition can alter bacterial membrane composition and permeability

  • Expression of plasmid-encoded proteins may compete with or regulate chromosomally-encoded membrane proteins

  • Selective pressures that maintain plasmids may co-select for alterations in membrane protein expression

How has whole genome sequencing enhanced our understanding of S. heidelberg virulence and resistance mechanisms?

Whole genome sequencing (WGS) has revolutionized the investigation of S. heidelberg outbreaks and the characterization of its resistance mechanisms. During the multidrug-resistant S. heidelberg outbreak linked to dairy calves, WGS played a pivotal role by:

  • Demonstrating close genetic relatedness between human and animal isolates, confirming the zoonotic transmission route

  • Identifying seven specific PFGE patterns associated with the outbreak strains

  • Detecting genetic determinants of resistance that correlated with observed phenotypic resistance profiles

The methodological workflow for WGS-based investigation includes:

  • DNA extraction from pure bacterial cultures

  • Library preparation and sequencing (typically using Illumina technology)

  • De novo assembly or reference-based alignment

  • Annotation and identification of resistance genes, virulence factors, and mobile genetic elements

  • Phylogenetic analysis to establish relationships between isolates

This approach has enabled researchers to:

  • Predict antimicrobial resistance from genetic markers with high accuracy

  • Identify novel resistance determinants like dfrA34

  • Understand the genetic context of resistance genes, including their association with mobile genetic elements

  • Track the evolution and spread of specific resistant clones

What are the optimal experimental design principles for studying membrane protein function in S. heidelberg?

Investigating membrane protein function in S. heidelberg requires careful experimental design that addresses the specific challenges of these proteins. The following methodological framework is recommended:

As noted in experimental design literature: "A good experimental design is characterized by the absence of systematic error. Experimental units should not differ in any systematic way from one another."

How can researchers effectively investigate the relationship between antimicrobial resistance and membrane protein alterations in S. heidelberg?

To investigate potential associations between antimicrobial resistance and membrane protein changes in S. heidelberg, researchers should employ a multifaceted approach:

  • Comparative genomics and transcriptomics:

    • Compare membrane protein gene sequences across resistant and susceptible isolates

    • Analyze transcriptional profiles under antibiotic pressure

    • Identify co-occurring genetic elements (like the dfrA34-sul1 arrangement)

  • Protein expression analysis:

    • Quantify membrane protein expression levels in resistant vs. susceptible strains

    • Investigate post-translational modifications

    • Examine membrane proteome changes following acquisition of resistance plasmids

  • Functional characterization:

    • Generate yeaL knockout mutants and assess antimicrobial susceptibility profiles

    • Complement with wild-type and modified versions of the gene

    • Measure membrane permeability and drug accumulation

  • Structural biology approaches:

    • Compare predicted structures (like those with pLDDT scores of 84.87) with experimental data

    • Investigate potential binding sites for antimicrobials

    • Model conformational changes upon substrate binding

  • Evolutionary analysis:

    • Track membrane protein sequence evolution alongside resistance development

    • Examine selection pressures on membrane protein genes in resistant lineages

    • Analyze horizontal gene transfer events affecting membrane protein genes and resistance determinants

Experimental ApproachAdvantagesLimitationsApplication to YeaL Research
Gene knockoutDirect assessment of functionPotential compensatory mechanismsDetermine essentiality and resistance contribution
Recombinant expressionControlled protein productionMay not reflect native conditionsStructural and biochemical characterization
TranscriptomicsGenome-wide expression patternsmRNA≠protein levelsIdentify co-regulated genes and stress responses
ProteomicsDirect protein quantificationMembrane protein extraction challengesMap YeaL interactions and modifications
Structural analysisInsight into mechanismComputational models need validationIdentify functional domains and binding sites

What survival mechanisms allow S. heidelberg to persist in environmental conditions, and how might membrane proteins contribute?

S. heidelberg demonstrates remarkable environmental persistence, with studies showing survival for up to 21 days in pine wood shavings (PWS) commonly used as broiler bedding . This persistence has significant implications for disease transmission and outbreak control.

The methodological approach to investigating these survival mechanisms involves:

  • Environmental challenge studies:

    • Inoculation of bacterial strains into relevant environmental matrices

    • Temporal sampling to track survival kinetics

    • Correlation analysis between environmental parameters and bacterial persistence

  • Genetic determinant analysis:

    • Comparison of persistent vs. non-persistent strains

    • Identification of genetic elements associated with survival

    • Investigation of plasmid and bacteriophage roles in persistence

Research has revealed several key findings:

  • S. heidelberg abundance decreases by approximately 4.4 Log<sub>10</sub> CFU/g over 21 days in PWS

  • Water activity of the substrate correlates with S. heidelberg survival

  • Strains carrying specific plasmids (notably, those with higher copy numbers of Col plasmids) demonstrate enhanced environmental persistence

  • Bacteriophage acquisition can occur between strains in environmental settings, potentially conferring survival advantages

Membrane proteins likely contribute to environmental persistence through:

  • Maintaining cellular integrity under desiccation stress

  • Regulating osmotic balance in variable moisture conditions

  • Facilitating nutrient acquisition in nutrient-limited environments

  • Potentially participating in biofilm formation on environmental surfaces

What novel approaches are being developed to target membrane proteins like YeaL for antimicrobial drug development?

The emergence of multidrug-resistant S. heidelberg strains with resistance to first-line treatments necessitates exploration of novel antimicrobial targets, with membrane proteins representing promising candidates. Current methodological approaches include:

  • Structure-based drug design:

    • Utilization of computational models (such as the AlphaFold model with pLDDT of 84.87)

    • Molecular docking simulations to identify potential binding sites

    • Fragment-based screening to develop novel inhibitors

  • Functional inhibition strategies:

    • Identification of critical residues through site-directed mutagenesis

    • Development of peptidomimetics that disrupt protein-protein interactions

    • Small molecule screening for functional inhibitors

  • Combination approaches:

    • Targeting membrane proteins alongside established antimicrobial targets

    • Developing adjuvants that enhance existing antibiotic efficacy by interfering with membrane protein function

    • Exploiting synergistic effects between membrane disruption and other antimicrobial mechanisms

  • Alternative therapeutic modalities:

    • Antimicrobial peptides targeting membrane structure

    • Bacteriophage-based approaches

    • Immunomodulatory strategies that enhance host defense mechanisms

Researchers must consider the challenges inherent in targeting membrane proteins, including the need for compounds that can access the bacterial membrane, specificity to avoid host toxicity, and the potential for resistance development.

How do environmental and host factors influence the expression and function of YeaL in S. heidelberg during infection?

Understanding the dynamic expression and function of membrane proteins like YeaL during the infection process requires investigation of host-pathogen interactions. The methodological framework includes:

  • In vivo expression analysis:

    • Animal infection models to track gene expression in different host niches

    • Ex vivo studies using host-derived fluids or cell cultures

    • RNA-seq and proteomics to monitor temporal changes in expression

  • Environmental sensing mechanisms:

    • Investigation of regulatory networks controlling yeaL expression

    • Characterization of response to environmental signals (pH, antimicrobials, nutrient availability)

    • Identification of transcription factors and small RNAs influencing expression

  • Host interaction studies:

    • Examination of YeaL's role in adhesion to host cells

    • Assessment of immunogenic properties

    • Investigation of potential interactions with host defense mechanisms

  • Infection stage-specific functions:

    • Analysis of YeaL contribution to initial colonization

    • Evaluation of role in invasion and intracellular survival

    • Assessment of importance during persistent infection

Research on related pathogens suggests that membrane protein expression patterns shift significantly during the transition from environmental reservoirs to host environments, which may explain the observation that strains with certain plasmid profiles demonstrate enhanced persistence both in the environment and during infection .

What are the challenges and solutions in developing recombinant expression systems for S. heidelberg membrane proteins?

Recombinant expression of membrane proteins presents unique challenges due to their hydrophobic nature and complex folding requirements. For S. heidelberg membrane proteins like YeaL, researchers must navigate several technical hurdles:

  • Expression system selection challenges:

    • Bacterial systems may struggle with proper membrane insertion

    • Eukaryotic systems may introduce inappropriate post-translational modifications

    • Cell-free systems often yield insufficient quantities

    Solution methodology: Screen multiple expression systems (E. coli, yeast, insect cells) with different promoters and induction conditions; consider membrane-targeted expression systems specifically designed for membrane proteins.

  • Protein folding and stability issues:

    • Misfolding and aggregation are common

    • Toxicity to host cells can limit expression

    • Native structure may depend on specific lipid environments

    Solution methodology: Optimize growth temperature (often lower temperatures improve folding); introduce fusion partners that enhance solubility; co-express chaperones; develop detergent screening protocols to identify optimal solubilization conditions.

  • Purification challenges:

    • Detergent selection affects protein stability and activity

    • Maintaining proper folding throughout purification

    • Achieving sufficient purity without compromising function

    Solution methodology: Implement systematic detergent screening; utilize lipid nanodiscs or amphipols as alternatives to detergents; develop streamlined purification protocols that minimize exposure to harsh conditions.

  • Functional characterization difficulties:

    • Traditional assays may not work in detergent solutions

    • Reconstitution into membranes can be inefficient

    • Activity may depend on specific lipid composition

    Solution methodology: Develop liposome reconstitution protocols; establish solid-supported membrane electrophysiology; implement label-free binding assays compatible with detergent environments.

ChallengeTraditional ApproachImproved MethodologyApplication to YeaL
Low expressionStrong promoters, high inducerMild induction, lower temperatureOptimize expression conditions based on growth curves
Protein aggregationDenaturing and refoldingFusion tags, specialized hostsTest multiple solubility tags (MBP, SUMO)
Detergent compatibilityTrial and errorSystematic detergent screeningDevelop stability assay across detergent panel
Functional assessmentSimplified in vitro assaysReconstitution into native-like environmentsEstablish proteoliposome systems

How might systems biology approaches enhance our understanding of membrane protein networks in antimicrobial-resistant S. heidelberg?

Systems biology offers powerful frameworks for understanding complex biological processes in antimicrobial-resistant S. heidelberg, particularly regarding membrane protein networks. Methodological approaches include:

  • Multi-omics integration:

    • Combine genomics, transcriptomics, proteomics, and metabolomics data

    • Develop computational models of membrane protein interactions

    • Identify emergent properties not evident from single-omics approaches

  • Network analysis methods:

    • Construct protein-protein interaction networks centered on YeaL

    • Identify hub proteins and critical nodes in membrane protein networks

    • Compare network architectures between susceptible and resistant strains

  • Flux balance analysis:

    • Model metabolic networks influenced by membrane transporters

    • Predict metabolic adaptations following antimicrobial exposure

    • Identify vulnerable nodes as potential therapeutic targets

  • Machine learning applications:

    • Develop predictive models for resistance emergence

    • Identify patterns linking membrane protein variations to phenotypic outcomes

    • Optimize experimental design through active learning approaches

These advanced approaches could reveal how membrane proteins like YeaL participate in broader cellular networks that contribute to antimicrobial resistance, environmental persistence, and virulence, potentially identifying new intervention strategies.

What ethical considerations and biosafety protocols should researchers implement when working with recombinant antimicrobial-resistant S. heidelberg strains?

Research involving recombinant antimicrobial-resistant S. heidelberg presents significant biosafety and ethical considerations that must be addressed through rigorous protocols:

  • Risk assessment methodology:

    • Evaluate both inherent pathogen risks and those associated with genetic modifications

    • Consider the potential consequences of horizontal gene transfer

    • Assess risks specifically related to creating strains with modified membrane proteins

  • Containment strategies:

    • Implement appropriate Biosafety Level (BSL) practices (typically BSL-2 with enhanced measures)

    • Establish specific protocols for handling multidrug-resistant strains

    • Develop strain-specific inactivation procedures and validate their effectiveness

  • Genetic safeguards:

    • Consider auxotrophic markers to limit environmental survival

    • Implement conditional expression systems when possible

    • Avoid unnecessary antibiotic resistance markers

  • Ethical review procedures:

    • Obtain appropriate institutional biosafety committee approvals

    • Document scientific justification for creating recombinant strains

    • Ensure research benefits outweigh potential risks

  • Data sharing considerations:

    • Develop protocols for responsible sharing of potentially sensitive data

    • Consider dual-use research implications

    • Balance transparency with security concerns

Given that S. heidelberg has been associated with significant outbreaks , researchers must be particularly vigilant when working with strains that may combine enhanced antimicrobial resistance with potential modifications to membrane proteins that could affect virulence or environmental persistence.

How can structural biology advances improve our understanding of YeaL function in S. heidelberg?

Structural biology techniques offer unprecedented insights into membrane protein function, with several methodological approaches applicable to understanding YeaL in S. heidelberg:

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Single-particle analysis for high-resolution structure determination

    • Tomography to visualize YeaL in its native membrane context

    • Time-resolved studies to capture conformational changes

  • Advanced computational methods:

    • Refinement of AlphaFold predictions (currently at pLDDT 84.87)

    • Molecular dynamics simulations to explore conformational flexibility

    • Integration of experimental constraints with computational models

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probe protein dynamics and solvent accessibility

    • Identify regions involved in ligand binding

    • Map conformational changes upon substrate interaction

  • Solid-state NMR techniques:

    • Determine membrane protein structure in lipid environments

    • Investigate protein-lipid interactions

    • Characterize dynamic processes on different timescales

  • Integrative structural biology:

    • Combine multiple experimental techniques (X-ray crystallography, NMR, cryo-EM)

    • Develop hybrid models incorporating diverse structural data

    • Validate computational predictions with experimental constraints

These approaches would significantly advance our understanding of YeaL's molecular mechanism, potentially revealing:

  • How its structure relates to antimicrobial resistance phenotypes

  • Structural changes that occur during environmental persistence

  • Potential binding sites for novel antimicrobial compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.