Recombinant Salmonella heidelberg UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Salmonella Heidelberg

While the exact biological function of YihY remains under investigation, genomic and proteomic studies suggest its involvement in:

  • Membrane integrity: As a membrane protein, YihY likely contributes to bacterial cell envelope structure and stress resistance .

  • Antimicrobial resistance: Co-occurrence with multidrug-resistant plasmids in S. Heidelberg implies potential roles in resistance gene regulation .

  • Virulence adaptation: Comparative genomic analyses highlight differences in YihY homologs between poultry-associated S. Heidelberg strains, suggesting niche-specific adaptations .

Research Applications

Recombinant YihY is utilized in diverse experimental contexts:

ApplicationUtility
ELISA and immunoassaysDetects antibodies in serological studies of Salmonella infections .
Proteomic studiesAnalyzes host-pathogen interactions and membrane protein dynamics .
Antimicrobial researchScreens for inhibitors targeting membrane-associated virulence factors .
Vaccine developmentEvaluated as a potential antigen for subunit vaccines .

Genomic and Proteomic Insights

  • Plasmid associations: YihY is encoded on plasmids that co-harbor antimicrobial resistance genes (e.g., blaCTX-M, sul1) and virulence factors (e.g., iron acquisition systems) .

  • Host-specific variations: S. Heidelberg isolates from poultry show distinct YihY-linked genomic regions compared to turkey-associated strains, implicating horizontal gene transfer .

  • Biofilm formation: Proteins like YihY may stabilize biofilms in hostile environments (e.g., poultry processing facilities) .

Challenges and Future Directions

  • Functional validation: Mechanistic studies are needed to clarify YihY’s role in antimicrobial resistance and virulence .

  • Structural resolution: Cryo-EM or X-ray crystallography could reveal binding sites for therapeutic targeting .

  • Epidemiological tracking: Monitoring YihY variations may aid in tracing S. Heidelberg outbreaks linked to poultry .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
yihY; SeHA_C4351; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
yihY
Target Protein Sequence
MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 membrane protein yihY in Salmonella heidelberg and how does it compare to similar proteins in other Salmonella species?

The UPF0761 membrane protein yihY is a membrane-associated protein found in Salmonella species including S. heidelberg. Based on comparative analysis with other Salmonella species like S. enteritidis, yihY appears to be a transmembrane protein with multiple membrane-spanning domains. The UPF (Uncharacterized Protein Family) designation indicates that while the protein has been identified, its precise function has not been fully characterized.

From studies on S. enteritidis, the yihY protein contains approximately 290 amino acids with multiple hydrophobic regions consistent with transmembrane domains . While specific data for S. heidelberg yihY is limited in the current literature, researchers can expect similar structural features given the general conservation of membrane proteins among Salmonella serotypes.

What methods should be used to assess conservation of yihY across different Salmonella serotypes?

For comprehensive conservation analysis, researchers should implement a multifaceted approach:

  • Sequence alignment: Perform multiple sequence alignment (MSA) using tools like MUSCLE or Clustal Omega to determine sequence identity and similarity percentages across serotypes.

  • Phylogenetic analysis: Construct phylogenetic trees to visualize evolutionary relationships and identify potential selective pressures on the gene.

  • Domain architecture analysis: Identify conserved functional domains and motifs using tools like PFAM or InterPro.

  • Structural prediction comparison: Compare predicted secondary and tertiary structures across serotypes.

Research on other S. heidelberg proteins has revealed both conservation and diversity. For example, the S. heidelberg FlgK protein shows conservation of its 553 amino acid sequence and molecular mass (61 kDa) while still exhibiting genetic diversity across isolates that allows for epitope mapping .

What expression systems are most effective for producing recombinant S. heidelberg yihY protein?

Based on successful expression of similar membrane proteins, including S. enteritidis yihY, the following methodological approach is recommended:

Table 1: Recommended Expression Systems for yihY Protein

Expression SystemAdvantagesConsiderationsTag Options
E. coli BL21(DE3)High yield, established protocolsMay require optimization for membrane proteinsHis-tag, MBP, GST
Insect cellsBetter for complex membrane proteinsHigher cost, longer timelineHis-tag, FLAG
Cell-free systemsAvoids toxicity issuesLower yield, higher costMultiple options
Yeast systemsPost-translational modificationsMay require codon optimizationHis-tag, Biotin

For E. coli-based expression (most commonly used):

  • Vectors with T7 promoters and appropriate fusion tags (His-tag as seen with S. enteritidis yihY) are recommended .

  • Lower expression temperatures (16-25°C) often improve membrane protein folding.

  • Codon optimization may be necessary if the S. heidelberg yihY gene contains rare codons.

  • IPTG concentration should be optimized (typically 0.1-0.5 mM) to prevent inclusion body formation.

What purification strategies yield the highest purity for recombinant yihY protein?

Optimal purification of membrane proteins like yihY requires specialized approaches:

  • Membrane extraction:

    • Detergent screening is crucial (common options: DDM, CHAPS, or Triton X-100)

    • Gentle extraction methods to preserve native conformation

    • Optimization of detergent:protein ratios

  • IMAC purification for His-tagged proteins:

    • Ni-NTA or Co-NTA resins with optimized imidazole gradients

    • Inclusion of appropriate detergent in all buffers

    • Slow flow rates to maximize binding efficiency

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography if needed for higher purity

    • Affinity chromatography with specific antibodies for exceptional purity

  • Quality assessment:

    • SDS-PAGE analysis with Western blotting confirmation

    • Mass spectrometry for identity verification

    • Circular dichroism to assess secondary structure integrity

What are the optimal storage conditions for maintaining stability of purified yihY protein?

Based on protocols for similar membrane proteins, including S. enteritidis yihY, the following storage conditions are recommended:

Table 2: Storage Conditions for Recombinant yihY Protein

Storage DurationTemperatureBuffer CompositionAdditional Considerations
Short-term (≤1 week)4°CTris/PBS-based, pH 8.0 with 6% TrehaloseAvoid detergent precipitation
Long-term-20°C/-80°CSame as above with 50% glycerolAliquot to avoid freeze-thaw cycles
Working solutions4°CApplication-dependentUse within 24-48 hours

For reconstitution of lyophilized protein:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Aliquot to prevent repeated freeze-thaw cycles which can cause protein degradation

What methods are most effective for epitope mapping of yihY protein?

Based on successful epitope mapping approaches used for other S. heidelberg proteins (such as FlgK), researchers should implement a dual approach combining in silico prediction and experimental validation:

In silico prediction methods:

  • Use multiple prediction algorithms (BepiPred, ABCpred, IEDB Analysis Resource)

  • Focus on surface-exposed regions based on structural predictions

  • Consider both linear and conformational epitopes

  • Apply molecular dynamics simulations to assess epitope accessibility

Experimental validation methods:

  • Generate polyclonal antibodies through immunization with purified recombinant yihY

  • Perform epitope extraction: proteolytically digest yihY, capture peptides with antibodies, and identify by mass spectrometry

  • Develop peptide arrays or ELISA with synthetic peptides covering predicted epitopes

  • Compare immunoreactivity between different S. heidelberg isolates to identify conserved epitopes

This integrated approach led to the successful identification of three consensus peptide epitope sequences in the S. heidelberg FlgK protein at positions 77-95, 243-255, and 358-373 .

How can researchers investigate the potential role of yihY in antimicrobial resistance?

Based on antimicrobial resistance studies of S. heidelberg isolates described in the literature, a comprehensive methodological framework includes:

  • Generate gene knockout or knockdown mutants:

    • CRISPR-Cas9 genome editing for clean deletions

    • Inducible expression systems to control yihY levels

    • Complementation studies to confirm phenotype specificity

  • Antimicrobial susceptibility testing:

    • Determine Minimum Inhibitory Concentrations (MICs) for relevant antibiotics

    • Perform time-kill assays to assess killing kinetics

    • Measure biofilm formation and antibiotic tolerance

  • Comparative analysis:

    • Compare MICs between clinical and environmental isolates

    • Analyze correlation between yihY sequence variants and resistance profiles

    • Examine expression levels in resistant versus susceptible strains

Research has shown that clinical S. heidelberg isolates often display significantly greater antimicrobial resistance than environmental isolates for multiple drugs, suggesting adaptation to selective pressures . Similar methodologies could reveal whether yihY contributes to these resistance phenotypes.

What approaches can verify the membrane localization and topology of yihY?

To definitively characterize the membrane localization and topology of yihY:

  • Subcellular fractionation:

    • Differential centrifugation to separate cytoplasmic, periplasmic, and membrane fractions

    • Western blot analysis with anti-yihY antibodies

    • Inclusion of known marker proteins as controls (e.g., OmpA for outer membrane)

  • Fluorescence microscopy:

    • Generate GFP-yihY fusion proteins

    • Perform colocalization studies with established membrane markers

    • Use super-resolution microscopy for detailed localization

  • Topology mapping:

    • Cysteine accessibility methods (SCAM)

    • PhoA/LacZ fusion analysis at different positions

    • Protease accessibility studies with spheroplasts

  • Computational prediction validation:

    • Compare experimental results with topology prediction algorithms (TMHMM, TOPCONS)

    • Refine structural models based on experimental data

How might yihY function in S. heidelberg virulence and pathogenesis?

While the specific role of yihY in S. heidelberg virulence is not yet fully characterized, researchers can investigate this using:

  • Comparative genomics:

    • Analyze yihY sequence conservation among virulent and avirulent strains

    • Identify genetic linkage with known virulence factors

    • Examine expression correlation with virulence-associated genes

  • Infection models:

    • Compare colonization efficiency between wild-type and yihY mutants

    • Measure invasion and intracellular survival in epithelial and macrophage cell lines

    • Assess competitive index in mixed infections

  • Host response analysis:

    • Measure inflammatory cytokine production induced by wild-type vs. yihY mutants

    • Assess interaction with host immune receptors

    • Determine effect on host cell membrane integrity

  • Gene expression profiling:

    • Analyze transcriptome changes in yihY mutants during infection

    • Identify genes co-regulated with yihY under host-mimicking conditions

    • Perform ChIP-seq to identify potential regulators of yihY expression

S. heidelberg isolates show significant genetic diversity with 18 unique PFGE patterns detected in some studies, which may contribute to differential virulence properties . Determining whether yihY variation correlates with these patterns could provide insights into its role in pathogenesis.

What structural biology approaches are most appropriate for determining the 3D structure of yihY?

For membrane proteins like yihY, researchers should consider multiple complementary structural biology approaches:

Table 3: Structural Biology Methods for yihY Protein

MethodResolution PotentialAdvantagesChallengesConsiderations
X-ray crystallographyHigh (1.5-3Å)Gold standard for atomic resolutionDifficult crystallizationDetergent screening, lipidic cubic phase methods
Cryo-EMMedium-High (2.5-4Å)No crystallization requiredSize limitationsAdvances now allow smaller membrane proteins
NMR spectroscopyMedium (solution dynamics)Dynamic informationSize limitationsIsotopic labeling required
Hybrid methodsVariableCombines strengths of multiple techniquesComplex data integrationComputationally intensive

Special considerations for membrane proteins:

  • Detergent selection is critical - screening different detergents for protein stability

  • Lipid nanodisc or amphipol reconstitution may better preserve native structure

  • Fusion with crystallization chaperones (e.g., T4 lysozyme) may improve crystal quality

  • Computational modeling can supplement experimental data when resolution is limited

How does the growth kinetics of S. heidelberg strains correlate with yihY expression?

Building on growth kinetic methodologies used in S. heidelberg research:

  • Experimental design:

    • Compare wild-type, yihY knockout, and yihY overexpression strains

    • Measure growth under various conditions (standard media, nutrient limitation, stress)

    • Determine doubling times using standardized methods

  • Expression correlation:

    • Perform qRT-PCR to measure yihY expression at different growth phases

    • Develop reporter strains with fluorescent proteins under yihY promoter control

    • Correlate expression with specific growth parameters

  • Comparative analysis:

    • Analyze strains from different sources (clinical vs. environmental)

    • Compare historical isolates with recent ones

    • Assess impact of environmental stressors on expression and growth

Research has shown that S. heidelberg isolates exhibit consistent doubling times ranging from 19.7 to 24.5 minutes under nutrient-rich conditions, with minimal variation across strains . Investigating whether yihY expression affects these growth kinetics could provide insights into its physiological function.

What are the key considerations for designing experiments to study yihY protein interactions?

To comprehensively characterize the protein-protein interaction network of yihY:

  • Affinity purification-mass spectrometry:

    • Express tagged yihY (His-tag, FLAG-tag) in S. heidelberg

    • Optimize membrane protein extraction conditions

    • Perform co-immunoprecipitation with appropriate controls

    • Use quantitative proteomics (SILAC or TMT labeling) to distinguish specific from non-specific interactions

  • Proximity-based labeling:

    • Generate BioID or TurboID fusions to yihY

    • Express in native conditions and activate labeling

    • Purify biotinylated proteins and identify by mass spectrometry

    • Validate interactions with orthogonal methods

  • Genetic interaction screening:

    • Perform synthetic genetic array analysis

    • Use CRISPR interference screens to identify genetic interactions

    • Conduct suppressor mutant analysis to identify compensatory pathways

  • Validation strategies:

    • Bacterial two-hybrid assays for direct interaction testing

    • FRET or BRET assays for in vivo interaction verification

    • Co-localization studies using fluorescence microscopy

How should researchers design epitope mapping studies to inform vaccine development?

Effective epitope mapping for vaccine development requires rigorous methodological considerations:

  • Comprehensive epitope identification:

    • Combine in silico prediction with experimental validation as demonstrated in S. heidelberg FlgK studies

    • Screen epitopes across diverse S. heidelberg isolates to ensure conservation

    • Assess cross-reactivity with other Salmonella serotypes

    • Evaluate epitope accessibility in the native protein

  • Immunological evaluation:

    • Test identified epitopes for immunogenicity in appropriate animal models

    • Assess protective efficacy against challenge

    • Determine antibody titers and persistence

    • Evaluate T-cell responses to candidate epitopes

  • Delivery platform considerations:

    • Peptide vaccines with appropriate adjuvants

    • Recombinant protein subunit vaccines

    • Nucleic acid vaccines (DNA or mRNA)

    • Live attenuated or vectored vaccines

  • Advanced technologies:

    • Reverse vaccinology approaches as successfully applied for other pathogens

    • mRNA vaccine technology encoding identified epitopes

    • Multiepitope constructs to enhance coverage and efficacy

What approaches can address the challenges of studying membrane proteins like yihY?

Membrane proteins present unique challenges requiring specialized methodologies:

  • Solubilization strategies:

    • Systematic detergent screening (non-ionic, zwitterionic, and mild ionic detergents)

    • Nanodiscs or styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Amphipol stabilization for structural and functional studies

    • Bicelle or liposome reconstitution for functional assays

  • Expression optimization:

    • Membrane protein-specific expression vectors with tunable promoters

    • Host strains engineered for membrane protein expression

    • Fusion with solubility-enhancing partners (MBP, SUMO)

    • Cell-free expression systems with supplied lipids or detergents

  • Functional characterization:

    • Liposome reconstitution for transport studies

    • Solid-supported membrane electrophysiology

    • Surface plasmon resonance for interaction studies

    • Native mass spectrometry for intact membrane protein complexes

  • Structural analysis adaptations:

    • Lipidic cubic phase crystallization

    • Electron crystallography of 2D crystals

    • Cryo-EM with latest generation detectors

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.