Recombinant Salmonella heidelberg Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in advance to enable preferential development.
Synonyms
zntB; SeHA_C1840; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella heidelberg (strain SL476)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGSWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ZntB in Salmonella heidelberg?

The protein forms a funnel-shaped structure composed of five identical subunits that together create a pore through the membrane. This pentameric arrangement facilitates the movement of zinc ions across the bacterial cell membrane . The intracellular domain contains chloride ion binding sites that may tune the funnel's properties to favor zinc ion passage over monovalent ions like sodium and potassium. Additionally, the structure reveals two rings of acidic amino acids at the funnel's base that may be involved in stripping water molecules from zinc ions before transport .

Is ZntB primarily involved in zinc import or export in Salmonella?

This question represents an area of ongoing scientific debate. While earlier studies suggested ZntB functions primarily as a zinc efflux system, more recent evidence indicates it may function as an importer under certain conditions.

Initial whole-cell assays identified ZntB as a Zn²⁺ and Cd²⁺ exporter, with mutations at the zntB locus conferring increased sensitivity to the cytotoxic effects of these cations . Direct transport activity analysis identified a capacity for Zn²⁺ efflux, supporting this characterization.

Current evidence indicates ZntB likely functions as a Zn²⁺/H⁺ co-transporter that can facilitate zinc import in a proton gradient-dependent manner, although its precise role may vary depending on physiological conditions and bacterial species.

How does ZntB differ from other zinc transporters in Salmonella?

ZntB differs from other zinc transporters in Salmonella in several key aspects:

TransporterFamilyPrimary FunctionDirectionStructureRegulation
ZntBCorA/MIT familyZinc transportDebated (efflux/import)Pentameric, funnel-shaped structureDownregulated at high Zn²⁺ concentrations
ZntAP-type ATPaseZinc effluxExportMonomeric, multiple TMDsUpregulated by Zn²⁺/ZntR
ZitBCDF familyZinc effluxExportDimeric, 6 TMDs per monomerConstitutive expression
ZnuABCABC transporterHigh-affinity zinc uptakeImportPeriplasmic binding protein + membrane componentsRegulated by Zur

Unlike ZnuABC, which is specifically dedicated to high-affinity zinc import during zinc limitation, ZntB appears to function under different physiological conditions. ZntB belongs to the CorA family of transporters but has evolved to transport zinc rather than magnesium . Its transport mechanism appears distinct from that of CorA magnesium channels, as ZntB does not collapse into a highly asymmetrical state upon depletion of divalent cations .

The ZntA and ZitB zinc efflux transporters play a complementary role to ZntB in zinc homeostasis and are required for Salmonella resistance to zinc overload and nitrosative stress. Together, these transporters help ameliorate the cytotoxic actions of free zinc within the bacterial cell .

What methods are most effective for expressing and purifying recombinant Salmonella heidelberg ZntB protein?

For effective expression and purification of recombinant Salmonella heidelberg ZntB protein, the following methodological approach is recommended:

Expression System:
E. coli is the preferred heterologous expression system for ZntB, as it provides high yields and relative ease of handling . BL21(DE3) strains typically work well for membrane protein expression. For optimal expression:

  • Clone the full-length ZntB coding sequence (978 bp encoding 327 amino acids) into an expression vector with an N-terminal His-tag (6x histidine) for purification purposes .

  • Transform the construct into E. coli BL21(DE3) cells.

  • Grow cultures at 37°C until OD₆₀₀ reaches 0.6-0.8.

  • Induce protein expression with 0.5 mM IPTG.

  • Continue incubation at a reduced temperature (18-25°C) for 4-16 hours to improve proper folding.

Purification Protocol:
Because ZntB is a membrane protein, specialized purification approaches are necessary:

  • Harvest cells and resuspend in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors.

  • Lyse cells using sonication or a cell disruptor.

  • Solubilize membrane fraction with detergent (typically 1% n-dodecyl-β-D-maltoside or 1% n-dodecylphosphocholine).

  • Purify using Ni-NTA affinity chromatography:

    • Bind: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 0.03% DDM, 10 mM imidazole

    • Wash: Same buffer with 20-30 mM imidazole

    • Elute: Same buffer with 250-300 mM imidazole

  • Further purify via size exclusion chromatography using a Superdex 200 column.

The final purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability . For long-term storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles.

How can researchers effectively reconstitute ZntB into liposomes for transport assays?

Reconstitution of ZntB into liposomes is critical for functional transport assays. The following protocol has been validated for effective reconstitution:

  • Preparation of Liposomes:

    • Prepare a lipid mixture containing E. coli polar lipid extract and phosphatidylcholine at a 3:1 ratio.

    • Dissolve lipids in chloroform, evaporate under a nitrogen stream, and further dry under vacuum.

    • Hydrate lipids to 10 mg/ml in reconstitution buffer (typically 50 mM HEPES-KOH pH 7.4, 100 mM KCl).

    • Perform freeze-thaw cycles (5-10 times) using liquid nitrogen and a 42°C water bath.

    • Extrude through 400 nm polycarbonate filters to form uniform liposomes.

  • Protein Incorporation:

    • Add Triton X-100 to destabilize preformed liposomes (use a detergent:lipid ratio of 2:1).

    • Add purified ZntB protein at a protein:lipid ratio of 1:50 to 1:100 (w/w).

    • Incubate for 30 minutes at room temperature with gentle agitation.

    • Remove detergent using Bio-Beads SM-2 (add 80 mg/ml of mixture and incubate for 2 hours).

    • Add fresh Bio-Beads twice more (30 mg/ml) and incubate overnight at 4°C.

    • Remove Bio-Beads and collect proteoliposomes by ultracentrifugation.

    • Resuspend in appropriate buffer for transport assays.

  • Verification of Incorporation:

    • Analyze protein orientation and incorporation efficiency using protease protection assays.

    • Assess liposome integrity using dynamic light scattering.

    • Verify protein functionality through initial transport assays using control substrates.

For zinc transport assays specifically, researchers have successfully used ⁶⁵Zn²⁺ as a radiotracer to measure uptake or efflux . Alternative approaches include fluorescent zinc-sensitive dyes like FluoZin-3, which allow real-time monitoring of transport activity without radioactive materials.

What are the most reliable methods for measuring ZntB-mediated zinc transport?

Several complementary approaches can be used to reliably measure ZntB-mediated zinc transport:

1. Radiotracer Assays Using ⁶⁵Zn²⁺:

  • Preload proteoliposomes with buffer containing desired internal ion composition.

  • Initiate transport by adding external buffer containing ⁶⁵ZnCl₂ (typically 6 μM).

  • At timed intervals, filter samples through nitrocellulose filters and wash with cold buffer containing EDTA (0.5 mM) to chelate external zinc.

  • Measure radioactivity using gamma counting to quantify zinc transport .

For efflux measurements:

  • Preload proteoliposomes with ⁶⁵Zn²⁺.

  • Dilute into zinc-free buffer and measure the remaining radioactivity at various time points.

2. Fluorescent Zinc Indicator Methods:

  • Encapsulate zinc-sensitive fluorophores (FluoZin-3, Zinpyr-1) inside liposomes during preparation.

  • Measure fluorescence changes in real-time as zinc is transported.

  • This method allows for continuous monitoring but requires careful calibration.

3. Isothermal Titration Calorimetry (ITC):

  • While not a direct transport assay, ITC provides valuable data on zinc binding parameters.

  • Measure thermodynamic parameters (Kd, ΔH, ΔS) of zinc binding to purified ZntB protein.

  • This information complements transport data and helps characterize the molecular mechanism .

4. pH Gradient-Driven Transport:
To test the hypothesis that ZntB functions as a Zn²⁺/H⁺ co-transporter:

  • Generate pH gradients across the liposome membrane using different internal and external buffer pH values.

  • Monitor zinc transport as a function of the pH gradient.

  • Include controls with protonophores like CCCP to collapse the pH gradient and confirm mechanism .

A standardized protocol for ⁶⁵Zn²⁺ uptake assays includes:

  • Grow bacterial cultures to OD₆₀₀ of 0.4 in supplemented minimal medium.

  • Wash cells twice with ice-cold medium without MgSO₄ and supplements.

  • Resuspend to OD₆₀₀ of 1.0-2.0.

  • Initiate uptake by adding cells to prewarmed medium containing 6 μM ⁶⁵ZnCl₂.

  • Filter 100-μl samples at timed intervals through 0.45-μm nitrocellulose filters.

  • Wash filters with 8 ml of cold buffer containing 0.5 mM EDTA.

  • Analyze radioactivity by gamma counting .

How does nitric oxide (NO) affect ZntB function and zinc homeostasis in Salmonella during infection?

Nitric oxide (NO) produced by activated macrophages significantly impacts ZntB function and broader zinc homeostasis in Salmonella during infection through several interconnected mechanisms:

  • Disruption of Zinc Metalloproteins:
    NO and related reactive nitrogen species (RNS) target zinc metalloproteins in Salmonella, including essential proteins involved in DNA replication (DnaG, PriA) and various metabolic activities. These modifications can disrupt protein function by interfering with zinc coordination .

  • Zinc Mobilization:
    NO exposure causes the release of zinc from zinc-binding proteins, resulting in elevated levels of free intracellular zinc, which is toxic to bacterial cells. This mobilization of zinc represents a key antimicrobial mechanism employed by macrophages .

  • ZntB Regulation in Response to NO Stress:
    While direct NO effects on ZntB remain incompletely characterized, the ZntA and ZitB zinc efflux transporters play crucial roles in mitigating NO-dependent zinc toxicity. These transporters are required for:

    • Resistance to zinc overload

    • Resistance to nitrosative stress in vitro

    • Amelioration of NO-dependent zinc mobilization following internalization by activated macrophages

    • Virulence in NO-producing mice

  • Impact on Bacterial Survival:
    Deletion of zinc efflux systems significantly reduces Salmonella survival during infection, demonstrating that management of NO-mobilized zinc is critical for pathogenesis. This highlights the broader importance of zinc homeostasis systems, including ZntB, during host-pathogen interactions .

The complex interplay between NO, zinc homeostasis, and bacterial survival represents a critical aspect of Salmonella pathogenesis. Current evidence suggests that effective zinc efflux, potentially involving ZntB alongside ZntA and ZitB, is essential for Salmonella to withstand host nitrosative stress responses during infection.

How do mutations in the zntB gene affect Salmonella heidelberg fitness in poultry litter and during infection?

Mutations in the zntB gene can significantly impact Salmonella heidelberg fitness in both poultry litter environments and during host infection through several mechanisms:

Impact in Poultry Litter Environment:
Poultry litter represents a complex extra-intestinal environment containing high levels of various metals, including zinc from feed additives and fecal material. Studies examining Salmonella heidelberg strains in poultry litter have demonstrated that:

  • Survival in poultry litter is strongly influenced by the bacterial strain's ability to manage metal stress, including zinc toxicity .

  • While specific zntB mutations haven't been directly characterized in this context, disruptions in zinc homeostasis systems generally reduce fitness in poultry litter environments.

  • Strains carrying certain plasmids (including IncX1 and ColE1) showed dramatically increased fitness in poultry litter, partially through mechanisms involving metal resistance .

Effects During Infection:
During infection, zntB mutations can impact Salmonella heidelberg fitness through:

  • Altered Zinc Homeostasis:

    • Mutations in zntB increase sensitivity to zinc and cadmium .

    • This sensitivity may be particularly detrimental during infection when the host employs nutritional immunity strategies, including zinc limitation and zinc toxicity.

  • Reduced Virulence:

    • Proper zinc homeostasis is essential for Salmonella virulence.

    • Zinc efflux systems are required for virulence in mouse models, suggesting zntB mutations could attenuate pathogenicity .

  • Increased Susceptibility to Nitrosative Stress:

    • Since zinc efflux ameliorates NO-dependent zinc mobilization following internalization by activated macrophages, zntB mutations may increase susceptibility to host immune responses .

  • Impact on Invasiveness:

    • Differential expression of genes involved in metal transport has been correlated with invasion ability in Salmonella heidelberg strains.

    • The more invasive strain SX 245 showed >2-fold higher invasion rates in human epithelial cells and >7-fold higher rates in bovine epithelial cells compared to less invasive strains .

These findings highlight the importance of zinc homeostasis, potentially mediated in part by ZntB, for Salmonella heidelberg adaptation to both environmental reservoirs and host environments during infection.

What are the current controversies regarding the transport mechanism of ZntB and how can they be resolved?

The transport mechanism of ZntB remains controversial, with conflicting evidence regarding its primary direction of transport and underlying mechanistic details. These controversies and potential resolution approaches include:

Current Controversies:

  • Import vs. Export Function:

    • Early studies classified ZntB as a zinc exporter based on whole-cell assays showing increased zinc sensitivity in zntB knockout strains .

    • Recent structural and transport studies suggest ZntB functions as a zinc importer stimulated by a pH gradient .

    • Regulatory studies show mixed results: downregulation of ZntB expression in some bacteria under high zinc conditions suggests an importer role, but this is not universal across species .

  • Transport Mechanism:

    • Despite structural similarity to CorA magnesium channels, ZntB appears to employ a distinct transport mechanism.

    • While CorA functions as a channel with rapid ion movement, ZntB may function as a transporter with conformational changes coupling energy to transport .

    • The specific coupling ion (H⁺) and stoichiometry remain debated.

  • Structural Dynamics:

    • Unlike CorA, which undergoes dramatic asymmetric conformational changes during transport, ZntB does not collapse into a highly asymmetrical state upon divalent cation depletion .

    • The precise conformational changes driving transport remain unclear.

Approaches to Resolve Controversies:

  • Complementary Transport Assays:

    • Conduct bidirectional transport assays using both inside-out and right-side-out vesicles to directly measure transport in both directions.

    • Use pH gradient manipulation and ionophores to determine the role of proton coupling.

    • Implement zinc isotope exchange experiments to differentiate between net transport and exchange.

  • Structural Studies of Different Conformational States:

    • Determine high-resolution structures of ZntB in different conformational states, including substrate-bound, transition, and release states.

    • Use techniques like cryo-EM with different substrate concentrations and pH conditions.

    • Employ molecular dynamics simulations to model conformational changes during the transport cycle.

  • Mutagenesis Studies:

    • Perform systematic mutagenesis of residues predicted to be involved in zinc binding, proton coupling, and conformational changes.

    • Assess the impact of these mutations on transport direction, rate, and coupling efficiency.

    • Target the chloride ion binding sites that tune the electrostatic properties of the transport pathway .

  • In vivo Studies with Fluorescent Zinc Sensors:

    • Develop genetically encoded zinc sensors to monitor zinc levels in different cellular compartments in real-time.

    • Compare zinc flux in wild-type, zntB mutant, and complemented strains under various conditions.

    • Correlate these results with physiological outcomes and stress responses.

  • Context-Dependent Function Analysis:

    • Investigate whether ZntB function changes based on environmental conditions, zinc concentrations, or pH gradients.

    • Explore the possibility that ZntB may function bidirectionally depending on cellular needs and electrochemical gradients.

Resolution of these controversies will require integration of structural, biophysical, and functional approaches to fully elucidate the transport mechanism of ZntB, which may represent a novel paradigm for metal transport distinct from both channels and traditional transporters.

What approaches can be used to study ZntB-mediated zinc transport in the context of whole bacterial cells?

Several sophisticated approaches can be employed to study ZntB-mediated zinc transport in whole bacterial cells:

1. Genetic Manipulation Approaches:

  • Create precise chromosomal deletions or mutations in zntB using CRISPR-Cas9 or lambda Red recombineering.

  • Develop complementation strains expressing wild-type or mutant ZntB proteins from plasmids with controlled expression levels.

  • Construct reporter strains with zinc-responsive promoters (like zntA promoter) fused to luciferase or fluorescent proteins to monitor intracellular zinc status.

2. Radioactive Zinc (⁶⁵Zn²⁺) Assays:
A standardized protocol for whole-cell ⁶⁵Zn²⁺ transport assays includes:

  • Grow cultures to OD₆₀₀ of 0.4 in minimal medium.

  • Wash cells twice with cold buffer to remove external zinc.

  • Preload cells with ⁶⁵Zn²⁺ (for efflux assays) or add ⁶⁵Zn²⁺ to external medium (for uptake assays).

  • At timed intervals, filter samples and wash with buffer containing EDTA.

  • Determine radioactivity by gamma counting .

For efflux measurements specifically:

  • Preload cells with ⁶⁵Zn²⁺ during growth.

  • Wash to remove external isotope.

  • Resuspend in zinc-free medium and monitor efflux over time by measuring remaining cellular radioactivity.

3. Fluorescent Zinc Probes:

  • Load cells with membrane-permeable fluorescent zinc indicators like FluoZin-3 AM.

  • Monitor fluorescence changes in response to zinc challenges or environmental perturbations.

  • Use flow cytometry to analyze zinc content at the single-cell level, revealing population heterogeneity.

4. Inductively Coupled Plasma Mass Spectrometry (ICP-MS):

  • Grow wild-type and zntB mutant strains under various conditions.

  • Harvest, wash, and digest cells.

  • Perform ICP-MS to precisely quantify total cellular zinc content.

  • This approach offers higher sensitivity than radioactive methods and can simultaneously measure multiple metals.

5. Zinc-Responsive Transcriptional Reporters:

  • Construct strains with zinc-responsive promoters fused to reporter genes.

  • Monitor reporter activity in real-time during growth under various zinc concentrations.

  • Compare responses between wild-type and zntB mutant strains to infer ZntB's role in zinc homeostasis.

6. Membrane Potential and pH Gradient Manipulation:

  • Use ionophores like valinomycin (disrupts membrane potential) or CCCP (collapses pH gradient).

  • Determine how these perturbations affect ZntB-mediated zinc transport to elucidate the energetics of transport.

  • This approach can help resolve whether ZntB functions as a channel or a secondary active transporter.

7. In vivo Crosslinking and Protein Interaction Studies:

  • Use in vivo crosslinking to identify interaction partners of ZntB.

  • Perform co-immunoprecipitation followed by mass spectrometry.

  • Map the protein interaction network to understand how ZntB functions within the broader zinc homeostasis system.

These methodologies provide complementary information about ZntB function in its native cellular environment and can help resolve outstanding questions about its physiological role and transport mechanism.

How can epitope mapping techniques be applied to study the immunogenicity of ZntB for vaccine development?

Epitope mapping of ZntB can be approached through both computational and experimental methods to identify immunogenic regions suitable for vaccine development:

1. In Silico Epitope Prediction Methods:

Several computational tools can predict potential B-cell and T-cell epitopes in ZntB:

  • B-cell epitope prediction:

    • BepiPred, ABCpred, and Ellipro for linear epitopes

    • DiscoTope and PEPOP for conformational epitopes

    • Tools should be used with the threshold set at 0.4 as default, with prediction accuracy of 70-89%

  • T-cell epitope prediction:

    • NetMHC for MHC class I binding

    • NetMHCII for MHC class II binding

    • Evaluate epitopes for population coverage using IEDB tools

  • Additional analyses:

    • Antigenicity prediction using VaxiJen (version 2.0)

    • Allergenicity assessment with AllerTOP (version 2.0)

    • Toxicity analysis using ToxinPred

    • Protein solubility evaluation with Protein-Sol server

    • Adhesion prediction using Vaxign2

2. Experimental Epitope Mapping Approaches:

For experimental validation of predicted epitopes:

  • Peptide Microarray Analysis:

    • Synthesize overlapping peptides (15-20 amino acids with 5-10 amino acid overlap) spanning the entire ZntB sequence

    • Print peptides on glass slides

    • Probe with sera from infected or immunized animals

    • Identify peptides that react with antibodies

  • Mass Spectrometry with Immunoprecipitation:

    • Express and purify recombinant ZntB protein (100 μg per animal)

    • Immunize animals (typically broiler chickens for poultry vaccines)

    • Collect sera after primary and booster immunizations

    • Digest the protein with proteases

    • Immunoprecipitate fragments that bind to antibodies

    • Identify bound peptides by mass spectrometry

  • X-ray Crystallography of Antibody-Antigen Complexes:

    • Generate monoclonal antibodies against ZntB

    • Form and crystallize antibody-antigen complexes

    • Determine the structure to identify precise epitope-paratope interactions

3. Case Study: Experimental Protocol for ZntB Epitope Mapping in Chickens:

Based on published methods for Salmonella proteins , a protocol for ZntB would include:

  • Produce recombinant ZntB protein:

    • Clone the full-length ZntB coding sequence

    • Express in E. coli and purify via affinity chromatography

    • Confirm purity by SDS-PAGE (>90% purity required)

  • Immunize broiler chickens:

    • Administer 100 μg of recombinant ZntB emulsified in Freund's incomplete adjuvant subcutaneously at one week of age

    • Give a booster dose at three weeks of age

    • Collect blood samples via venipuncture at five weeks of age

  • Process samples for epitope mapping:

    • Separate serum from blood samples

    • Perform immunoprecipitation of peptide fragments

    • Analyze by mass spectrometry

  • Validation and characterization:

    • Synthesize identified epitope peptides

    • Test immunogenicity in animals

    • Evaluate protective efficacy against challenge

4. Integration of Computational and Experimental Approaches:

A study on Salmonella FlgK protein identified three common consensus peptide epitope sequences using both in silico and in vivo approaches . A similar integrative approach for ZntB would:

  • Perform computational prediction of epitopes

  • Conduct experimental validation

  • Identify consensus epitopes present in both analyses

  • Focus vaccine development on these validated epitopes

This combined approach yields higher confidence in the identified epitopes and increases the likelihood of developing an effective vaccine against Salmonella heidelberg targeting ZntB.

What approaches can be used to investigate the role of ZntB in Salmonella heidelberg pathogenesis and virulence?

Investigating the role of ZntB in Salmonella heidelberg pathogenesis requires a multi-faceted approach combining genetic, molecular, cellular, and in vivo techniques:

1. Genetic Manipulation and Characterization:

  • Creation of Defined Mutants:

    • Generate precise zntB deletion mutants using λ-Red recombineering

    • Construct complemented strains expressing wild-type ZntB from plasmids

    • Create point mutants targeting specific functional domains (e.g., zinc binding sites, transmembrane domains)

  • Transcriptional Profiling:

    • Use RNA-seq to compare wild-type and ΔzntB strains under various conditions (standard media, zinc limitation, zinc excess, acidic pH, oxidative stress)

    • Identify compensatory changes in expression of other zinc transporters or virulence factors

2. In Vitro Virulence Assays:

  • Invasion and Intracellular Survival:

    • Compare invasion rates of wild-type and ΔzntB strains in relevant cell lines (human HEp-2 and bovine MDBK epithelial cells)

    • Quantify intracellular survival over time in macrophages (RAW264.7, THP-1)

    • Assess the impact of zinc supplementation or chelation on these phenotypes

  • Resistance to Host Defense Mechanisms:

    • Evaluate survival under nitrosative stress (using NO donors like GSNO)

    • Test resistance to antimicrobial peptides

    • Assess survival in the presence of neutrophil extracellular traps (NETs)

3. Advanced Cellular and Molecular Approaches:

  • Intracellular Zinc Dynamics:

    • Use genetically encoded zinc sensors to monitor zinc levels in bacteria during infection

    • Track zinc fluxes in response to host defense mechanisms

  • Microscopy-Based Techniques:

    • Employ super-resolution microscopy to visualize ZntB localization during infection

    • Use fluorescence resonance energy transfer (FRET) to investigate protein-protein interactions

  • Protein-Protein Interaction Studies:

    • Perform bacterial two-hybrid or pull-down assays to identify interaction partners

    • Map the ZntB interactome under normal and infection-relevant conditions

4. In Vivo Infection Models:

  • Animal Models of Infection:

    • Compare colonization, dissemination, and persistence of wild-type and ΔzntB strains in appropriate animal models (mice, chickens)

    • Evaluate tissue-specific bacterial burdens

    • Assess inflammatory responses and pathology

  • Competitive Index Assays:

    • Co-infect animals with wild-type and ΔzntB strains at a 1:1 ratio

    • Recover bacteria from tissues at various time points

    • Calculate the competitive index to quantify fitness differences in vivo

  • Host Response Analysis:

    • Measure cytokine/chemokine profiles in infected tissues

    • Assess recruitment of immune cells

    • Evaluate antibody responses to infection

Case Study Example: Experimental Design

Based on published approaches for studying Salmonella virulence factors, a comprehensive investigation of ZntB might include:

  • Initial Characterization:

    • Compare growth of wild-type and ΔzntB strains under various zinc concentrations

    • Determine minimal inhibitory concentrations (MICs) for zinc and other metals

    • Assess impact of zntB deletion on resistance to oxidative and nitrosative stress

  • Cellular Infection Studies:

    • Quantify invasion efficiency in epithelial cells:

      • Infect HEp-2 cells (MOI 10:1) for 1 hour

      • Add gentamicin to kill extracellular bacteria

      • Lyse cells and enumerate intracellular bacteria by plating

    • Based on published data for Salmonella heidelberg strains, wild-type strains typically show invasion rates of 0.58-1.35% in human epithelial cells and 1.73-12.12% in bovine epithelial cells

  • Mouse Infection Model:

    • Use streptomycin-pretreated mouse model for intestinal colonization

    • Assess competitive fitness by co-infecting with wild-type and ΔzntB strains

    • Measure bacterial burdens in intestinal contents, Peyer's patches, mesenteric lymph nodes, spleen, and liver

This multi-faceted approach would provide comprehensive insights into the role of ZntB in Salmonella heidelberg pathogenesis across different stages of infection.

How might ZntB be exploited as a target for novel antimicrobial strategies against Salmonella heidelberg?

ZntB presents several promising avenues for novel antimicrobial development against Salmonella heidelberg:

1. Direct Inhibition of ZntB Function:

  • Develop small molecule inhibitors that block the ZntB transport channel

  • Target the zinc binding sites or residues critical for conformational changes

  • Design inhibitors that lock ZntB in an inactive conformation

  • Employ structure-based drug design using the available structural data on ZntB

2. Zinc Homeostasis Disruption Strategies:

  • Exploit ZntB's role in zinc homeostasis by designing compounds that cause toxic zinc accumulation

  • Develop dual-action agents that simultaneously inhibit zinc efflux systems and increase intracellular zinc levels

  • Create zinc ionophores that bypass normal transport systems and deliver toxic amounts of zinc intracellularly

3. Vaccine Development Targeting ZntB:

  • Identify immunogenic epitopes in ZntB for subunit vaccine development

  • Use shared linear epitopes identified through epitope mapping for broad-spectrum protection

  • The conserved nature of ZntB among Salmonella isolates makes it a promising vaccine target

  • Focus on the three consensus peptide epitope sequences identified through integrative approaches

4. Adjunctive Therapies to Enhance Existing Antibiotics:

  • Combine ZntB inhibitors with conventional antibiotics to enhance efficacy

  • Target zinc homeostasis to sensitize resistant strains to existing antimicrobials

  • Develop compounds that interfere with zinc-dependent resistance mechanisms

5. Novel Delivery Systems:

  • Use nanoparticle-based delivery systems for ZntB inhibitors

  • Develop phage-based delivery systems targeting Salmonella heidelberg

  • Design prodrugs that are specifically activated in the Salmonella intracellular environment

6. Host-Directed Therapies:

  • Modulate host zinc homeostasis to enhance natural antimicrobial mechanisms

  • Increase NO production to synergize with zinc-targeting approaches

  • Target host factors that interact with bacterial zinc homeostasis systems

7. Predictive Challenges and Solutions:

  • Anticipate resistance mechanisms by studying compensatory changes in zinc transport systems

  • Design multi-target approaches that simultaneously affect multiple zinc transporters

  • Develop diagnostic tools to identify strains with altered zinc homeostasis systems

The scientific rationale for targeting ZntB is particularly strong given that:

  • Zinc homeostasis is essential for Salmonella virulence and survival during infection

  • ZntB has no close homologs in mammalian cells, reducing the risk of off-target effects

  • Inhibition of zinc transport systems has shown promise in attenuating bacterial virulence in various models

  • The conserved nature of ZntB makes it a broad-spectrum target across Salmonella strains

Each of these approaches requires careful validation through in vitro and in vivo studies to determine efficacy and safety profiles before clinical development.

What are the key research gaps in understanding the regulatory mechanisms controlling ZntB expression?

Several critical knowledge gaps exist regarding the regulatory mechanisms controlling ZntB expression in Salmonella heidelberg:

1. Transcriptional Regulation:

  • The specific transcription factors controlling zntB expression remain poorly characterized

  • While zinc efflux transporter ZntA is regulated by the zinc-responsive transcriptional regulator ZntR, the corresponding regulator for ZntB is not definitively established

  • The precise promoter architecture and cis-regulatory elements of the zntB gene require detailed mapping

  • Potential roles for global regulators such as Fur, OxyR, or SoxRS in zntB regulation during oxidative or nitrosative stress remain unexplored

2. Post-Transcriptional Regulation:

  • The role of small RNAs in modulating zntB mRNA stability or translation efficiency is unknown

  • Potential riboswitches or other RNA-based regulatory mechanisms have not been investigated

  • The half-life and degradation mechanisms of zntB mRNA under different conditions require characterization

3. Environmental Signal Integration:

  • How multiple environmental signals (zinc levels, pH, oxidative stress, nitrosative stress) are integrated to control ZntB expression is poorly understood

  • The regulatory crosstalk between different metal homeostasis systems during infection needs elucidation

  • The impact of host-derived signals on zntB expression during infection remains largely unexplored

4. Strain-Specific Regulation:

  • Comparative analysis of regulatory mechanisms across different Salmonella heidelberg strains is lacking

  • Whether regulatory mutations contribute to differences in virulence between strains is unknown

  • Regulatory adaptations specific to poultry-associated strains have not been systematically investigated

5. Host-Pathogen Interface:

  • How host zinc sequestration or intoxication strategies influence zntB expression during infection

  • The regulatory changes occurring specifically within macrophages or intestinal epithelial cells

  • The impact of inflammatory mediators on zntB expression

6. Methodological Approaches to Address These Gaps:

To address these knowledge gaps, several methodological approaches are recommended:

  • Transcriptional Profiling:

    • Perform RNA-seq analysis of Salmonella heidelberg under various zinc concentrations and stress conditions

    • Use chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors binding to the zntB promoter region

    • Employ 5' RACE to precisely map transcription start sites

  • Promoter Characterization:

    • Create reporter fusions with the zntB promoter region

    • Perform systematic mutagenesis of potential regulatory elements

    • Use electrophoretic mobility shift assays (EMSAs) to identify protein-DNA interactions

  • Post-Transcriptional Analysis:

    • Employ RNA immunoprecipitation to identify RNA-binding proteins interacting with zntB mRNA

    • Use RNA structurome analysis to identify potential regulatory RNA structures

    • Investigate the role of small RNAs through differential sRNA expression analysis

  • In vivo Regulation Studies:

    • Develop reporter strains expressing fluorescent proteins under the control of the zntB promoter

    • Monitor zntB expression in real-time during infection of host cells

    • Isolate bacteria from different host tissues to analyze condition-specific regulation

Understanding these regulatory mechanisms will provide crucial insights into Salmonella heidelberg pathogenesis and potentially reveal new targets for antimicrobial intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.