Recombinant Salmonella newport 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction to UbiA Superfamily and Salmonella newport

The UbiA superfamily of intramembrane prenyltransferases has recently attracted significant scientific interest due to its involvement in a wide variety of biological processes and diseases. These enzymes catalyze key biosynthetic steps in the production of essential lipophilic compounds, including ubiquinones, menaquinones, plastoquinones, hemes, chlorophylls, vitamin E, and structural lipids . These compounds serve crucial roles as electron and proton carriers for cellular respiration and photosynthesis, as antioxidants reducing cell damage, and as structural components of microbial cell walls and membranes .

Within this superfamily, Salmonella newport UbiA specifically catalyzes the second step in ubiquinone biosynthesis. Ubiquinones are electron carriers essential for bacterial and mitochondrial respiratory chains, with potent antioxidant activity that protects membranes against lipid peroxidation . The fusion of the quinone ring with the isoprenoid side chain during ubiquinone biosynthesis represents an evolutionarily conserved and rate-limiting step that is catalyzed by UbiA in prokaryotes and COQ2 in eukaryotes .

Salmonella newport, a significant pathogen responsible for various clinical diseases ranging from gastroenteritis to more severe conditions like septicemia and meningitis, depends on UbiA for proper electron transport and cellular respiration. In Providencia stuartii, a related enterobacterium, mutations in the UbiA homolog (aarE) have been shown to result in a small-colony phenotype and altered gene expression patterns, highlighting the importance of this enzyme beyond just its role in ubiquinone biosynthesis .

Biochemical Significance of UbiA in Cellular Metabolism

UbiA functions as a parahydroxybenzoate octaprenyltransferase, catalyzing the addition of a prenyl group to 4-hydroxybenzoate. This reaction represents a critical junction between two important metabolic pathways: the shikimate pathway, which produces aromatic compounds including 4-hydroxybenzoate, and the isoprenoid pathway, which generates the prenyl donors . The resultant lipophilic compounds have the ideal chemical properties for their biological functions: the quinone ring allows for reversible redox activity, while the isoprenoid side chain confers solubility in the membrane .

Evolutionary Conservation of UbiA

The UbiA enzyme is highly conserved across bacterial species, with significant sequence homology observed between different organisms. For instance, the UbiA protein from Providencia stuartii (referred to as AarE) displays 61% amino acid identity and 74% similarity to the Escherichia coli UbiA protein . Complementation experiments have demonstrated that these genes are functionally equivalent, with the P. stuartii aarE gene able to complement E. coli ubiA mutants and vice versa . This high degree of conservation underscores the essential nature of this enzyme in bacterial metabolism.

Primary Structure and Domain Organization

Salmonella newport UbiA is a 290-amino acid protein that shares significant structural features with other members of the UbiA superfamily. The enzyme contains a transmembrane domain with multiple α-helices that anchor it within the cell membrane. Two highly conserved aspartate-rich motifs are present in the protein sequence, which are crucial for coordinating the divalent metal ions required for catalytic activity .

Substrate Recognition Mechanism

The UbiA superfamily is characterized by distinctive substrate preferences, with different members recognizing structurally diverse substrates . Recent crystal structures of UbiA superfamily members have provided insights into the general mechanism of substrate recognition. UbiA and MenA (another member of the superfamily) recognize prenyl diphosphates (XPPs) of various chain lengths, whereas other members are specific to certain XPP lengths .

The catalytic mechanism involves the cleavage of the diphosphate group from the XPP substrate, generating a highly reactive carbocation intermediate at the end of the isoprenyl chain. This carbocation then reacts regiospecifically at the meta-position of the aromatic 4-hydroxybenzoate substrate to form a carbon-carbon bond . This general mechanism is likely conserved in Salmonella newport UbiA.

Enzymatic Function and Mechanism

Salmonella newport UbiA catalyzes the transfer of a prenyl group from octaprenyl diphosphate to 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate. This reaction is a critical step in ubiquinone biosynthesis, linking the aromatic ring structure derived from the shikimate pathway with the prenyl side chain derived from isopentenyl diphosphate formed by the 2-C-methyl-D-erythritol 4-phosphate (non-mevalonate) pathway .

The catalytic mechanism involves the generation of a carbocation intermediate through the cleavage of the diphosphate group from the prenyl donor. This reactive intermediate then attacks the aromatic ring of 4-hydroxybenzoate, forming a new carbon-carbon bond . This reaction requires precise positioning of both substrates within the active site of the enzyme.

Metal Ion Requirements and Cofactors

Like other UbiA family enzymes, Salmonella newport UbiA requires divalent metal ions for optimal activity. These metal ions, particularly magnesium (Mg²⁺), coordinate with the pyrophosphate group of the prenyl donor, facilitating its departure during the reaction . Other divalent metal ions such as cobalt and nickel can also support enzymatic activity, albeit at lower levels.

Table 1: Metal Ion Requirements for UbiA Activity (Based on Studies of Related UbiA Enzymes)

Metal IonRelative Activity (%)Role in Catalysis
Mg²⁺100Primary cofactor, coordinates with pyrophosphate
Co²⁺30-60Alternative cofactor, lower efficiency
Ni²⁺20-40Alternative cofactor, lower efficiency
Mn²⁺10-30Minimal support of activity
Ca²⁺<10Limited catalytic support
Zn²⁺<5Negligible activity

Optimal Conditions for Enzymatic Activity

Based on studies of related UbiA enzymes, optimal activity is typically observed under slightly alkaline conditions (pH 8.5-9.0) and may require reducing conditions maintained by agents such as dithiothreitol (DTT) . The membrane-bound nature of the enzyme necessitates the presence of appropriate detergents or phospholipids to maintain its native conformation and function when studied in vitro.

Expression in Escherichia coli

Recombinant Salmonella newport UbiA can be expressed in E. coli expression systems. The full-length 290-amino acid protein is typically expressed with an N-terminal polyhistidine (His) tag to facilitate purification. This approach allows for high-level expression and subsequent purification of the functional enzyme .

Various E. coli strains can be employed for expression, with consideration given to codon usage, protein folding capabilities, and the presence or absence of endogenous UbiA. For functional studies, specialized E. coli strains with knockout of related genes (like menA and endogenous ubiA) can be used to prevent interference from host proteins .

Purification Strategies

The purification of recombinant Salmonella newport UbiA generally follows a multi-step process:

  1. Cell lysis: Mechanical or chemical disruption of E. coli cells to release the membrane-bound UbiA protein

  2. Membrane isolation: Separation of membrane fractions containing the UbiA protein

  3. Solubilization: Use of appropriate detergents to solubilize the membrane-bound enzyme

  4. Affinity chromatography: Utilization of the N-terminal His tag for purification on nickel or cobalt affinity resins

  5. Further purification: Size exclusion or ion exchange chromatography if higher purity is required

The purified enzyme is often available in lyophilized form and requires reconstitution in an appropriate buffer containing detergent to maintain solubility and activity.

Challenges in Expression and Purification

As a membrane protein, recombinant expression and purification of Salmonella newport UbiA presents several challenges:

  1. Low expression levels often observed with membrane proteins

  2. Potential toxicity to the host cells when overexpressed

  3. Difficulty in maintaining the native conformation during solubilization and purification

  4. Requirement for specific detergents or lipid environments to maintain activity

  5. Stability issues during storage and handling

These challenges necessitate careful optimization of expression conditions, solubilization methods, and purification protocols to obtain sufficient quantities of active enzyme for biochemical and structural studies.

Activity Assays

Several methods can be employed to assess the enzymatic activity of recombinant Salmonella newport UbiA:

  1. Radiochemical assays using ¹⁴C-labeled substrates

  2. High-performance liquid chromatography (HPLC) to monitor product formation

  3. Coupled enzymatic assays measuring pyrophosphate release

  4. Thin-layer chromatography to analyze reaction products

In P. stuartii, UbiA activity has been assessed by examining the ability of cells to grow on medium containing succinate as the sole carbon source, which requires functional ubiquinone under aerobic conditions . Direct examination of ubiquinone production by thin-layer chromatography has also been employed, with wild-type strains producing a strong signal with an Rf value of 0.20 and a peak absorbance at 273 nm in ethanol, while UbiA mutants show no detectable ubiquinone .

Kinetic Parameters and Substrate Specificity

While specific kinetic data for Salmonella newport UbiA is limited in the available literature, studies on related UbiA enzymes suggest that these enzymes generally follow Michaelis-Menten kinetics. The enzyme appears to have relatively low substrate affinity, which is common among membrane-bound enzymes working in a confined environment.

UbiA exhibits specificity for both the prenyl donor (typically octaprenyl diphosphate) and the aromatic acceptor (4-hydroxybenzoate). This specificity is crucial for the proper biosynthesis of ubiquinone with the correct prenyl chain length, which varies among different organisms.

Role in Cellular Respiration and Electron Transport

In Salmonella and other bacteria, UbiA plays a critical role in ubiquinone biosynthesis, which is essential for electron transport and cellular respiration. Ubiquinones function as electron carriers in the respiratory chain, accepting electrons from various dehydrogenases and transferring them to terminal oxidases . This function is crucial for energy production under aerobic conditions.

Impact of UbiA Deficiency

Studies in related bacteria have shown that UbiA mutations or deficiencies result in several phenotypic effects:

  1. Small-colony phenotype due to impaired electron transport and energy production

  2. Inability to grow on medium containing succinate as the sole carbon source under aerobic conditions

  3. High-level aminoglycoside resistance independent of specific aminoglycoside-modifying enzymes

  4. Reduced numbers of flagella and non-motile phenotype, possibly related to defects in electron transport

  5. Altered gene expression patterns, including decreased levels of certain mRNAs

In P. stuartii, a UbiA homolog (aarE) mutation resulted in high-level aminoglycoside resistance, a finding consistent with previous studies establishing that high-level aminoglycoside resistance can result from alterations in electron transport, including ubiquinone deficiency .

Metabolic Engineering for Enhanced Ubiquinone Production

Recombinant Salmonella newport UbiA has potential applications in metabolic engineering efforts aimed at enhancing ubiquinone production. As a key enzyme in the ubiquinone biosynthetic pathway, manipulation of UbiA expression or activity could potentially increase the yield of this valuable bioenergetic compound, which has applications in the pharmaceutical and nutraceutical industries.

Development of Novel Antimicrobial Strategies

Understanding the structure and function of Salmonella newport UbiA could contribute to the development of novel antimicrobial strategies. Since ubiquinone biosynthesis is essential for bacterial respiration and survival, inhibitors targeting UbiA might serve as effective antibiotics against Salmonella and other bacterial pathogens. The fact that high-level aminoglycoside resistance can result from ubiquinone deficiency suggests complex interactions between ubiquinone biosynthesis and antibiotic susceptibility that warrant further investigation .

Protein Prenylation Technologies

The prenylation activity of UbiA enzymes has applications in site-specific protein labeling for biotechnology. Recombinant Salmonella newport UbiA could potentially be utilized in developing novel protein modification techniques that exploit its ability to catalyze the attachment of prenyl groups to aromatic substrates.

References The UbiA superfamily of intramembrane aromatic prenyltransferases catalyzes a key biosynthetic step in the production of ubiquinones, menaquinones, plastoquinones, and other essential lipophilic compounds. Mutations in aarE, the ubiA homolog of Providencia stuartii, result in high-level aminoglycoside resistance and reduced expression of the AAC(2')-Ia protein. Biosynthesis of Menaquinone (Vitamin K2) and Ubiquinone (Coenzyme Q) involves pathways derived from the shikimate pathway, with different mechanisms for introducing the prenyl side chain.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
ubiA; SNSL254_A4577; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
ubiA
Target Protein Sequence
MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This recombinant *Salmonella newport* 4-hydroxybenzoate octaprenyltransferase (UbiA) catalyzes the prenylation of para-hydroxybenzoate (PHB) using an all-trans polyprenyl group. It mediates the second step in ubiquinone-8 (UQ-8) biosynthesis, specifically the condensation of the polyisoprenoid side chain with PHB, generating the membrane-bound intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its fundamental role?

4-Hydroxybenzoate octaprenyltransferase, encoded by the ubiA gene, is an essential enzyme in the ubiquinone (coenzyme Q) biosynthetic pathway. The enzyme catalyzes the prenylation of 4-hydroxybenzoate, forming 3-octaprenyl-4-hydroxybenzoate, a critical intermediate in ubiquinone production. Based on studies in related organisms, this membrane-bound enzyme requires Mg²⁺ for optimal catalytic activity and functions as part of the electron transport chain machinery essential for cellular respiration . In Salmonella Newport, particularly in multidrug-resistant strains such as REPJJP01, the role of ubiA may be significant for both metabolic function and potentially contributing to resistance mechanisms .

How is the ubiA gene structured and conserved across Salmonella species?

The ubiA gene encodes an α-helical protein comprising nine transmembrane domains without a large carboxy-terminal region. Structural analysis demonstrates that most functionally significant mutation sites are localized in five specific transmembrane domains: T1, T2, T6, T7, and T9 . While complete conservation data specific to Salmonella Newport is limited in current literature, comparative genomics approaches suggest considerable conservation of ubiquinone biosynthesis genes across Enterobacteriaceae, with potential serotype-specific variations that may correlate with ecological niches or resistance profiles.

What experimental approaches are recommended for initial characterization of Salmonella Newport ubiA?

For researchers beginning work on Salmonella Newport ubiA, a methodological approach should include:

  • Gene amplification and sequencing to confirm the presence and sequence of ubiA

  • Comparative sequence analysis with other Salmonella serotypes to identify conserved regions

  • Expression analysis under different growth conditions to determine regulation patterns

  • Preliminary membrane fraction isolation to confirm protein production and localization

  • Basic enzymatic assays to verify 4-hydroxybenzoate octaprenyltransferase activity

These initial characterizations provide the foundation for more advanced functional and structural studies.

What expression systems are most effective for recombinant Salmonella Newport ubiA production?

Selecting an appropriate expression system for ubiA requires consideration of several factors due to its nature as a membrane protein with multiple transmembrane domains. Based on approaches used for similar enzymes:

Expression SystemAdvantagesDisadvantagesBest Applications
E. coli pET seriesHigh yield, established protocolsPotential inclusion body formationStructural studies requiring large amounts
BL21(DE3) pLysSReduced basal expression, suitable for toxic proteinsMay require optimization for membrane protein insertionStandard biochemical characterization
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesHigher cost, specialized equipmentDifficult-to-express variants, directed evolution
Baculovirus-insect cellBetter folding of complex membrane proteinsLonger production time, more complexFunctional studies requiring native conformation

Most studies of bacterial prenyltransferases have effectively utilized E. coli expression systems with specialized vectors containing promoters that allow modulated expression levels to prevent toxicity while maintaining proper membrane insertion .

What purification strategies preserve native conformation and activity of ubiA?

A robust purification strategy for recombinant Salmonella Newport ubiA should prioritize maintaining native conformation and activity:

  • Membrane fraction isolation: Differential centrifugation following cell disruption, with careful optimization of buffer conditions to maintain transmembrane domain stability

  • Solubilization: Selection of mild detergents (DDM, LMNG, or digitonin) that preserve protein-protein and protein-lipid interactions

  • Affinity chromatography: Utilizing carefully positioned tags that do not interfere with transmembrane domains

  • Buffer optimization: Inclusion of Mg²⁺ throughout purification, as it is required for optimal activity

  • Stabilization: Addition of substrate analogs or lipids that maintain protein stability

  • Activity verification: Regular enzymatic assays during purification to monitor functional integrity

The purification protocol must account for the destabilizing effects of removing the enzyme from its native membrane environment, particularly considering that mutations can significantly affect protein stability as indicated by positive ΔΔG values .

How can researchers overcome challenges in expressing functional recombinant ubiA?

Researchers frequently encounter challenges when expressing membrane proteins like ubiA. Methodological solutions include:

  • Codon optimization for the expression host to enhance translation efficiency

  • Fusion partners (MBP, SUMO, Mistic) to improve folding and solubility

  • Reduced expression temperature (16-25°C) to slow protein production and allow proper folding

  • Co-expression with chaperones to assist correct folding

  • Induction optimization using lower inducer concentrations for extended periods

  • Expression of truncated constructs or individual domains for structural studies

  • Addition of specific lipids that promote proper membrane protein folding

Successful expression must balance yield with proper folding and membrane insertion, as improperly folded ubiA will lack the critical Mg²⁺-dependent activity characteristic of functional enzyme .

How do mutations in specific transmembrane domains affect ubiA function?

Mutations in ubiA transmembrane domains can significantly impact protein stability and function. Computational modeling predicts that most point mutations result in destabilizing effects on protein structure, as indicated by positive ΔΔG values . The transmembrane domains T1, T2, T6, T7, and T9 contain most mutation sites observed in clinical studies. Specific mutations like A39E and W175C have been computationally predicted to damage ubiA function .

The effects of these mutations can include:

  • Altered substrate binding affinity

  • Disrupted Mg²⁺ coordination

  • Compromised membrane insertion

  • Destabilized protein structure leading to degradation

  • Modified catalytic efficiency

These structural changes may explain the correlation between ubiA mutations and phenotypic changes such as antimicrobial resistance observed in pathogens.

What methods provide the most reliable assessment of ubiA enzymatic activity?

For rigorous assessment of recombinant Salmonella Newport ubiA enzymatic activity, researchers should implement a multi-method approach:

  • Radiometric assays:

    • Incubation with 4-hydroxybenzoate and radiolabeled prenyl pyrophosphate

    • Extraction of lipid-soluble products and quantification by scintillation counting

    • Provides high sensitivity for kinetic parameter determination

  • HPLC-based methods:

    • Separation of substrate and product compounds

    • UV detection at 250-280nm for aromatic compounds

    • Allows precise quantification of reaction progress

  • Mass spectrometry:

    • LC-MS/MS identification of reaction products

    • Enables detection of unexpected reaction products or side reactions

    • Useful for complex samples where multiple prenylated products may form

  • Coupled enzyme assays:

    • Detection of pyrophosphate release using auxiliary enzymes

    • Real-time monitoring of reaction progress

    • Higher throughput for inhibitor screening

All assays should include appropriate controls, including heat-inactivated enzyme, reactions without Mg²⁺ (required cofactor), and substrate specificity controls .

How do structure-function relationships in ubiA inform drug development strategies?

Understanding structure-function relationships in ubiA can guide rational drug design approaches targeting ubiquinone biosynthesis:

  • The Mg²⁺ binding site represents a critical target, as the enzyme requires this cofactor for optimal activity . Compounds that interfere with metal coordination could selectively inhibit enzyme function.

  • The substrate binding pockets for 4-hydroxybenzoate and prenyl donors offer opportunities for competitive inhibitors. The transmembrane nature of these sites presents challenges but also opportunities for developing lipophilic inhibitors.

  • Allosteric sites, particularly at interfaces between transmembrane domains, could be targeted by compounds that lock the enzyme in inactive conformations.

  • Protein-protein interaction surfaces, if ubiA functions in complexes with other enzymes in the ubiquinone biosynthetic pathway, provide additional targeting options.

Computational approaches using homology models based on related prenyltransferases can identify potential binding pockets and guide virtual screening of compound libraries for potential inhibitors.

How might ubiA mutations contribute to antimicrobial resistance in Salmonella Newport?

While the direct relationship between ubiA mutations and resistance in Salmonella Newport is not explicitly documented in the provided search results, insights can be drawn from related research. In Mycobacterium tuberculosis, mutations in ubiA contribute to ethambutol resistance . For Salmonella Newport, several mechanisms may apply:

  • Alterations in membrane composition: Ubiquinone is an essential component of bacterial membranes. Modifications in ubiA could alter membrane composition, potentially affecting permeability to antimicrobials.

  • Energy metabolism changes: As ubiquinone is crucial for electron transport and energy production, ubiA mutations might modify energy-dependent processes like efflux pump activity, contributing to multidrug resistance phenotypes observed in strains like REPJJP01 .

  • Pleiotropic effects: Changes in ubiquinone biosynthesis may trigger compensatory mechanisms that indirectly affect susceptibility to multiple drug classes.

  • Stress response modulation: Altered ubiquinone levels may impact bacterial stress responses, potentially enhancing survival under antimicrobial pressure.

Further research is needed to establish direct correlations between specific ubiA mutations and resistance profiles in Salmonella Newport.

What genomic approaches can detect and characterize ubiA mutations in clinical isolates?

For comprehensive detection and characterization of ubiA mutations in clinical Salmonella Newport isolates, researchers should consider:

  • Targeted sequencing:

    • PCR amplification of the ubiA gene region

    • Sanger sequencing for identification of point mutations

    • High-resolution melt analysis for rapid screening

  • Whole genome sequencing approaches:

    • Short-read sequencing (Illumina) for comprehensive SNP detection

    • Long-read sequencing (PacBio, Oxford Nanopore) for structural variations and context

    • Comparative genomics with reference strains

  • Transcriptomic analysis:

    • RNA-Seq to assess expression levels and potential regulatory mutations

    • RT-qPCR for targeted expression analysis

  • Population-level surveillance:

    • Screening collections of clinical isolates to establish mutation frequencies

    • Temporal analysis to track evolutionary trajectories

    • Geographic mapping to identify regional patterns

These approaches have been successfully applied to track the evolution of multidrug-resistant Salmonella serotypes, including Newport MDR-AmpC isolates , and could be adapted specifically for ubiA mutation analysis.

How can experimental design distinguish between causative and coincidental ubiA mutations?

To establish causal relationships between ubiA mutations and phenotypic changes such as antimicrobial resistance, researchers should implement rigorous experimental designs:

  • Genetic complementation studies:

    • Introduction of wild-type ubiA into mutant strains to restore susceptibility

    • Expression of mutant ubiA in susceptible backgrounds to confer resistance

    • Site-directed mutagenesis to introduce specific mutations of interest

  • Quasi-experimental approaches:

    • Interrupted time series analysis of clinical isolates before and after resistance emergence

    • Comparative analysis of matched susceptible and resistant isolates

    • Multi-center studies to control for geographical variation

  • Biochemical validation:

    • In vitro assessment of enzymatic activity for wild-type versus mutant proteins

    • Measurement of ubiquinone levels in bacterial membranes

    • Membrane composition analysis to determine downstream effects

  • Statistical considerations:

    • Multivariate analysis to control for confounding factors

    • Sufficient sample sizes to achieve statistical power

    • Corrections for multiple testing when screening numerous mutations

These approaches should be designed according to established hierarchies of evidence in quasi-experimental studies to yield convincing evidence for causal links .

How can CRISPR-Cas9 genome editing advance Salmonella Newport ubiA research?

CRISPR-Cas9 technology offers transformative approaches for studying ubiA function:

  • Precise genetic manipulation:

    • Introduction of point mutations to recapitulate those observed in clinical isolates

    • Creation of knockout mutants to establish gene essentiality

    • Insertion of reporter tags for protein localization studies

  • Regulatory element analysis:

    • Promoter modifications to study expression regulation

    • Introduction of inducible systems for temporal control of expression

    • Deletion of potential regulatory sequences to identify control mechanisms

  • High-throughput applications:

    • CRISPR interference (CRISPRi) for tunable gene repression

    • CRISPR activation (CRISPRa) for enhanced expression

    • CRISPR screens to identify genetic interactions with ubiA

  • Technical considerations for Salmonella Newport:

    • Optimization of transformation protocols for clinical isolates

    • Selection of appropriate Cas9 delivery methods (plasmid vs. protein-RNA complex)

    • Design of guide RNAs specific to Salmonella Newport ubiA sequences

These approaches can overcome limitations of traditional genetic manipulation methods, particularly for clinical isolates that may be challenging to transform using conventional techniques.

What biophysical techniques are most informative for studying ubiA structure-function relationships?

Advanced biophysical techniques offer insights into ubiA structure and function that complement genetic and biochemical approaches:

  • Structural analysis:

    • X-ray crystallography (challenging for membrane proteins but potentially informative)

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • NMR spectroscopy for dynamic analyses of specific domains or regions

  • Interaction studies:

    • Surface plasmon resonance for binding kinetics with substrates or inhibitors

    • Isothermal titration calorimetry for thermodynamic parameters of binding

    • Microscale thermophoresis for detecting interactions in near-native conditions

  • Conformational dynamics:

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational changes

    • FRET-based approaches for monitoring protein dynamics in real-time

    • Single-molecule techniques to observe heterogeneity in enzyme behavior

  • In silico methods:

    • Molecular dynamics simulations of ubiA in membrane environments

    • Quantum mechanics/molecular mechanics calculations for reaction mechanism studies

    • Protein stability predictions for evaluating mutation effects on ΔΔG values

The integration of multiple biophysical approaches provides a comprehensive understanding of how ubiA structure relates to its function in ubiquinone biosynthesis.

What are the optimal experimental designs for studying ubiA in the context of Salmonella Newport pathogenesis?

To elucidate the role of ubiA in Salmonella Newport pathogenesis, researchers should consider:

  • In vitro infection models:

    • Cell culture systems with relevant cell types (intestinal epithelial cells, macrophages)

    • Measurement of invasion, intracellular survival, and replication

    • Comparison of wild-type, ubiA mutant, and complemented strains

  • In vivo approaches:

    • Animal models reflecting human Salmonella Newport infections

    • Tracking of bacterial burden, distribution, and persistence

    • Assessment of host immune responses to different ubiA variants

  • Mixed infection studies:

    • Competition assays between wild-type and ubiA mutant strains

    • Calculation of competitive indices to quantify fitness differences

    • Tissue-specific analyses to identify niches where ubiA function is critical

  • Systems biology integration:

    • Transcriptomics of both pathogen and host during infection

    • Metabolomics to assess changes in ubiquinone and related compounds

    • Network analysis to situate ubiA in broader pathogenesis pathways

These experimental designs should account for the multidrug-resistant nature of many clinical Salmonella Newport isolates, such as the REPJJP01 strain that has been implicated in outbreaks linked to various food sources .

How has the ubiA gene evolved across Salmonella serotypes and related pathogens?

Evolutionary analysis of ubiA provides context for understanding its role in Salmonella Newport:

  • Sequence conservation analysis:

    • Alignment of ubiA sequences across diverse Salmonella serotypes

    • Identification of highly conserved regions likely essential for function

    • Detection of serotype-specific variations that may relate to niche adaptation

  • Selection pressure assessment:

    • Calculation of dN/dS ratios to identify regions under positive or purifying selection

    • Analysis of codon usage patterns for evidence of translational selection

    • Identification of potential recombination events that have shaped gene evolution

  • Comparative pathogen analysis:

    • Examination of ubiA in related Enterobacteriaceae (E. coli, Klebsiella, etc.)

    • Comparison with more distant bacterial pathogens with characterized prenyltransferases

    • Assessment of convergent evolution in resistance-associated mutations

  • Temporal analysis:

    • Study of ubiA sequence changes in persistent strains like REPJJP01 over time

    • Correlation of evolutionary changes with antimicrobial usage patterns

    • Estimation of mutation rates in different bacterial lineages

This evolutionary context is essential for interpreting the significance of mutations observed in clinical isolates and may provide insights into future evolutionary trajectories.

What bioinformatic approaches best identify functional domains and critical residues in ubiA?

Sophisticated bioinformatic analyses can reveal functional architecture of ubiA:

  • Sequence-based approaches:

    • Multiple sequence alignment of ubiA homologs across diverse bacteria

    • Identification of conserved motifs associated with prenyltransferase activity

    • Calculation of conservation scores to pinpoint functionally constrained residues

  • Structure-based methods:

    • Homology modeling using related prenyltransferase structures as templates

    • Identification of potential substrate binding pockets and catalytic residues

    • Prediction of transmembrane topology to map the nine transmembrane domains

  • Machine learning applications:

    • Feature extraction from sequence and structural data

    • Classification of residues by functional importance

    • Prediction of effects of novel mutations on protein stability and function

  • Network analysis:

    • Co-evolution analysis to identify residues that function together

    • Protein-protein interaction prediction to identify potential binding partners

    • Pathway integration to situate ubiA in the broader context of ubiquinone biosynthesis

These approaches are particularly valuable for membrane proteins like ubiA, where experimental structural determination remains challenging.

How do horizontal gene transfer events influence ubiA diversity and function?

Horizontal gene transfer (HGT) may play an important role in ubiA evolution and function:

  • Detection methods:

    • Anomalous GC content or codon usage patterns indicative of recent HGT

    • Phylogenetic incongruence between ubiA and species trees

    • Identification of mobile genetic element signatures near ubiA loci

  • Functional implications:

    • Assessment of whether transferred ubiA variants confer selective advantages

    • Experimental comparison of native versus horizontally acquired ubiA function

    • Evaluation of expression differences between native and transferred genes

  • Association with resistance elements:

    • Analysis of genetic linkage between ubiA and resistance determinants

    • Investigation of co-transfer patterns in clinical isolates

    • Assessment of whether ubiA is part of mobilizable resistance islands

  • Evolutionary consequences:

    • Determination of how HGT events have shaped ubiA diversity

    • Analysis of adaptation following gene acquisition

    • Prediction of future transfer potential and resulting phenotypic changes

What emerging technologies show the most promise for advancing Salmonella Newport ubiA research?

Several cutting-edge technologies are poised to transform research on Salmonella Newport ubiA:

  • Single-cell approaches:

    • Single-cell sequencing to capture heterogeneity in bacterial populations

    • Microfluidic systems for high-throughput phenotypic screening

    • Single-cell proteomics to assess ubiA expression at individual cell level

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing membrane protein organization

    • Correlative light and electron microscopy to connect structure with function

    • Live-cell imaging to track dynamics of ubiquinone biosynthesis

  • Synthetic biology tools:

    • Cell-free expression systems optimized for membrane proteins

    • Minimal genome approaches to isolate essential functions

    • Biosensors for real-time monitoring of ubiquinone production

  • Computational advances:

    • AlphaFold and related AI methods for improved structural prediction

    • Molecular dynamics simulations at extended timescales

    • Quantum mechanical approaches for reaction mechanism elucidation

These technologies promise to overcome traditional limitations in studying membrane proteins like ubiA, potentially leading to breakthroughs in understanding its structure, function, and role in resistance.

What are the most promising targets for inhibiting ubiA function in drug-resistant Salmonella Newport?

Strategic targeting of ubiA could yield new approaches to combat multidrug-resistant Salmonella Newport:

  • Active site targeting:

    • Development of competitive inhibitors for 4-hydroxybenzoate binding

    • Design of prenyl pyrophosphate analogs that block the prenyl donor site

    • Identification of transition state mimics that inhibit the prenylation reaction

  • Allosteric inhibition:

    • Targeting interfaces between transmembrane domains to lock the protein in inactive conformations

    • Disruption of protein dynamics essential for catalytic cycling

    • Interference with membrane insertion or protein-lipid interactions

  • Cofactor interference:

    • Competition for the Mg²⁺ binding site essential for activity

    • Development of metal chelators with specificity for the ubiA active site

    • Modulation of cofactor accessibility through membrane interactions

  • Combination approaches:

    • Dual targeting of ubiA and other enzymes in the ubiquinone biosynthetic pathway

    • Synergistic inhibition of ubiA and resistance determinants

    • Adjuvant therapies that enhance efficacy of existing antimicrobials

Targeting ubiA may be particularly effective against persistent multidrug-resistant strains like REPJJP01 , potentially restoring susceptibility to conventional antibiotics.

How might systems biology approaches enhance understanding of ubiA's role in Salmonella Newport biology?

Integrative systems biology approaches offer comprehensive insights into ubiA function:

  • Multi-omics integration:

    • Combination of genomics, transcriptomics, proteomics, and metabolomics data

    • Correlation of ubiA sequence variations with global expression patterns

    • Identification of compensatory mechanisms activated by ubiA mutations

  • Network modeling:

    • Construction of protein-protein interaction networks centered on ubiA

    • Metabolic flux analysis of ubiquinone biosynthesis under various conditions

    • Regulatory network mapping to understand ubiA expression control

  • Host-pathogen interface:

    • Dual RNA-Seq during infection to capture both host and pathogen responses

    • Identification of infection contexts where ubiA function is critical

    • Modeling of how ubiA-dependent processes affect virulence and persistence

  • Population-level analyses:

    • Integration of clinical metadata with molecular characterization

    • Epidemiological modeling of transmission of ubiA variants

    • Prediction of emergence and spread of novel resistance mechanisms

These systems approaches could reveal unexpected connections between ubiA function and broader aspects of Salmonella Newport biology, potentially identifying novel intervention strategies for multidrug-resistant strains like REPJJP01 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.