Recombinant Salmonella newport Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Salmonella Newport Electron Transport Complex Protein RnfE (rnfE)

Recombinant Salmonella Newport Electron Transport Complex Protein RnfE (rnfE) is a bacterial membrane protein involved in electron transport and energy metabolism. It is part of the Rnf (Rhodobacter nitrogen fixation) complex, which facilitates ion translocation across membranes and contributes to redox balance . This recombinant variant is engineered for research applications, enabling studies on bacterial physiology, antibiotic resistance mechanisms, and metabolic pathways.

Amino Acid Sequence

The full-length sequence (1-230aa) is:
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
This sequence is conserved across Salmonella Newport lineages, reflecting its critical role in bacterial electron transport .

Expression and Purification Protocol

  • Expression System: E. coli

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

  • Purity: >90% (SDS-PAGE validation) , though some commercial sources report ≥85% purity .

Functional Insights

  • Electron Transport: RnfE is a subunit of the Rnf complex, which transfers electrons from NADH to quinones, contributing to membrane potential generation .

  • Antibiotic Resistance: S. Newport lineages carrying rnfE (e.g., Lineage II) often exhibit multidrug resistance (MDR), including resistance to cephalosporins . While RnfE itself is not a resistance factor, its role in energy metabolism may support survival under stress .

Comparative Studies

  • Lineage-Specific Variations:

    • Lineage II: Associated with MDR strains (e.g., ST31, ST45) linked to livestock and global outbreaks .

    • Lineage III: Primarily pansusceptible and human-associated in North America .
      RnfE’s sequence conservation across lineages suggests its essentiality in S. Newport physiology .

Future Research Directions

  • Investigate RnfE’s interaction with other Rnf complex subunits (e.g., RnfC, RnfD) .

  • Explore its role in biofilm formation or persistence in host environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences you may have. Please include your request in the order notes and we will do our best to fulfill it.
Lead Time
Delivery times may vary based on your purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please let us know and we will prioritize its development for your order.
Synonyms
rsxE; SNSL254_A1564; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that plays a crucial role in coupling electron transfer with the translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Electron Transport Complex Protein RnfE in Salmonella newport and what is its primary function?

The Electron Transport Complex Protein RnfE (also referred to as rsxE in some literature) is a component of the ion-translocating oxidoreductase complex in Salmonella newport. The protein consists of 230 amino acids and functions as part of the electron transport chain, facilitating redox reactions crucial for bacterial energy metabolism. RnfE contains membrane-spanning domains, as evidenced by its amino acid sequence which includes several hydrophobic regions that likely form transmembrane helices. The protein plays an essential role in the anaerobic respiration process, helping to establish electrochemical gradients across the bacterial membrane that drive ATP synthesis .

What expression systems are most effective for producing recombinant Salmonella newport RnfE protein?

The most effective expression system documented for producing recombinant Salmonella newport RnfE protein is Escherichia coli. Based on available research data, E. coli expression systems have successfully produced the full-length protein (spanning amino acids 1-230) with N-terminal His-tags to facilitate purification. When expressing this membrane-associated protein, it is critical to optimize growth conditions, including temperature, induction timing, and media composition to maximize protein yield while maintaining proper folding. Typical expression protocols involve transformation of expression plasmids into BL21(DE3) or similar E. coli strains, followed by IPTG induction and expression verification via SDS-PAGE analysis .

How should researchers properly reconstitute and store recombinant RnfE protein to maintain structural integrity?

For optimal reconstitution of lyophilized recombinant RnfE protein, researchers should use deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. Following reconstitution, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard practice) to prevent damage during freeze-thaw cycles. The reconstituted protein should be aliquoted to minimize repeated freeze-thaw events and stored at -20°C/-80°C for long-term preservation. For working stocks, storage at 4°C is suitable for up to one week, but repeated freezing and thawing should be strictly avoided as this leads to protein degradation and loss of activity. Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom and ensure maximum recovery of the protein .

What methodological approaches are most suitable for studying interactions between RnfE and antimicrobial compounds like Microcin J25?

To study interactions between RnfE and antimicrobial compounds such as Microcin J25 (MccJ25), researchers should implement a multi-faceted approach combining biophysical and biological techniques. Biophysical methods should include isothermal titration calorimetry (ITC) to quantify binding affinities and surface plasmon resonance (SPR) to determine kinetic parameters of interaction. For functional studies, membrane potential assays using fluorescent probes can assess whether MccJ25 disrupts RnfE-mediated electron transport.

Additionally, researchers can adapt the methodology used in studies of MccJ25 against Salmonella Newport, which employed propidium-monoazide-coupled quantitative PCR (PMA-qPCR) to quantify bacterial viability after antimicrobial exposure. This technique distinguishes between viable and non-viable cells by selective DNA amplification. For confirmation of interaction specificity, competitive binding assays with known RnfE substrates would provide further evidence of direct interaction. Mass spectrometry-based approaches, particularly LC-MS as utilized in MccJ25 stability studies, can quantify compound levels in complex biological matrices over time, helping determine if RnfE affects antimicrobial stability .

How can researchers effectively distinguish between phenotypic effects of RnfE mutations versus those resulting from compensatory mechanisms in Salmonella newport?

Distinguishing between direct phenotypic effects of RnfE mutations and compensatory mechanisms requires a systematic experimental design combining genetic, biochemical, and physiological approaches. Researchers should first establish a clean genetic system using precise gene editing techniques such as CRISPR/Cas9 to create specific RnfE mutations while minimizing off-target effects. Complementation studies, where wild-type RnfE is reintroduced into mutant strains, provide crucial evidence for direct causation.

Time-course transcriptomic and proteomic analyses can identify early versus late changes in gene expression and protein levels following RnfE mutation, helping separate primary effects from secondary adaptations. Metabolic flux analysis using isotope-labeled substrates can track changes in electron transport chain function and broader metabolic networks. Additionally, researchers should implement conditional expression systems (e.g., tetracycline-inducible promoters) to modulate RnfE levels and observe immediate versus adaptive responses.

For robust data interpretation, comparisons should include multiple control strains, including those with mutations in related but distinct electron transport components, allowing researchers to differentiate between general stress responses and RnfE-specific effects. Statistical analyses should account for the temporal dynamics of these responses, potentially using mixed-effects models that incorporate time as a factor.

What analytical techniques should be employed to characterize structural changes in RnfE under different redox conditions?

Characterizing structural changes in RnfE under varying redox conditions requires complementary biophysical approaches that capture dynamic conformational shifts. Circular dichroism (CD) spectroscopy should be employed to monitor secondary structural elements (α-helices and β-sheets) and their alterations upon exposure to different redox potentials. For higher-resolution analysis, researchers should conduct hydrogen/deuterium exchange mass spectrometry (HDX-MS) to identify specific regions experiencing conformational changes by measuring deuterium incorporation rates.

Electron paramagnetic resonance (EPR) spectroscopy is essential for directly observing the redox centers within RnfE and tracking electron transfer events. This can be complemented with fluorescence spectroscopy using intrinsic tryptophan fluorescence or site-specific fluorescent labels to monitor local conformational changes. Crosslinking coupled with mass spectrometry (XL-MS) allows identification of distance constraints between protein regions under different redox states.

For membrane-embedded portions of RnfE, solid-state NMR or cryo-electron microscopy would provide structural insights in a near-native environment. Computational approaches, including molecular dynamics simulations parameterized with experimental redox potentials, can predict conformational ensembles under different redox conditions. Researchers should establish standardized buffer systems with precise redox potential control using redox couples (e.g., GSH/GSSG) at physiologically relevant concentrations to ensure reproducibility across experiments.

How can RnfE be utilized as a potential target for developing novel antimicrobial strategies against Salmonella newport?

RnfE represents a promising target for novel antimicrobial development against Salmonella newport due to its essential role in electron transport and energy metabolism. To exploit this target, researchers should first conduct comprehensive inhibitor screening campaigns using both in silico approaches (molecular docking against the RnfE structure) and high-throughput biochemical assays measuring electron transport activity. Compounds that specifically disrupt RnfE function without affecting mammalian electron transport components should be prioritized.

Structure-activity relationship (SAR) studies can guide the optimization of lead compounds, focusing on increasing specificity and reducing potential off-target effects. An effective approach would be to design peptidomimetics based on antimicrobial peptides like Microcin J25, which has demonstrated potent activity against Salmonella Newport with minimal inhibitory concentration (MIC) values as low as 0.03 μM in laboratory media . This approach leverages natural antimicrobial mechanisms while enhancing stability and bioavailability.

For validation, researchers should implement assays similar to those used in the PolyFermS intestinal model studies, which effectively demonstrated antimicrobial activity under conditions mimicking the swine proximal colon. This model allows for testing antimicrobial efficacy in complex biological environments that more closely resemble in vivo conditions than simple laboratory media . Target engagement studies, such as thermal shift assays or surface plasmon resonance, would confirm direct binding to RnfE, while mutational studies of the RnfE gene would identify resistance mechanisms and inform counter-strategies in antimicrobial design.

What is the relationship between RnfE function and Salmonella newport virulence in host infection models?

The relationship between RnfE function and Salmonella newport virulence requires detailed investigation using both in vitro and in vivo approaches. Researchers should generate precise RnfE knockout and point mutant strains using CRISPR-Cas9 genome editing to evaluate the impact on virulence-associated phenotypes. Cell culture infection models using epithelial cells and macrophages would assess bacterial invasion efficiency, intracellular survival, and replication rates of wild-type versus RnfE-deficient strains.

Metabolomic studies would be valuable for determining whether RnfE-mediated electron transport affects the production of virulence-associated metabolites or adaptation to host microenvironments. The connection between RnfE function and the bacterial stress response, particularly under conditions mimicking those encountered during infection (nutrient limitation, oxidative stress, antimicrobial peptides), should be systematically characterized. Using techniques similar to those employed in CRISPR-MVLST studies of Salmonella Newport outbreaks would help establish whether specific RnfE variants correlate with increased virulence or transmission potential in clinical isolates .

What are the optimal conditions for maintaining RnfE stability during functional assays?

Maintaining RnfE stability during functional assays requires careful attention to buffer composition, temperature, and additive selection. The optimal buffer system should mimic the bacterial membrane environment where RnfE naturally functions. Researchers should use Tris/PBS-based buffers (pH 8.0) supplemented with 6% trehalose as a stabilizing agent, as indicated in product specifications . Since RnfE is a membrane protein, inclusion of appropriate detergents or lipid nanodiscs is crucial for maintaining native conformation outside the membrane context.

For functional electron transport assays, the buffer should contain physiologically relevant concentrations of electrolytes, particularly sodium and potassium, to support ion-translocating activities. Temperature control is essential, with assays ideally conducted at 30-37°C to reflect bacterial physiological conditions while minimizing protein denaturation. Reducing agents such as DTT or β-mercaptoethanol at 1-5 mM should be included to maintain redox-sensitive residues in their appropriate states.

To prevent protein aggregation during longer assays, low concentrations (0.1-0.5%) of non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin can be added. For activity measurements, researchers should incorporate appropriate electron donors and acceptors relevant to the RnfE electron transport pathway. Stabilizing agents such as glycerol (5-10%) and bovine serum albumin (0.1-0.5 mg/mL) can further enhance protein stability without interfering with functional assays.

What methodological approaches are most effective for studying RnfE protein-protein interactions within the electron transport complex?

Studying RnfE protein-protein interactions within the electron transport complex requires a combination of biochemical, biophysical, and genetic approaches. Co-immunoprecipitation using antibodies against RnfE or its interacting partners (with appropriate epitope tags if necessary) provides initial evidence of physical associations. This should be followed by more quantitative techniques such as bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) to assess interactions in real-time and in living bacterial cells.

For detailed interaction mapping, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify specific regions involved in protein-protein contacts by measuring changes in deuterium incorporation rates upon complex formation. Crosslinking mass spectrometry provides complementary data by capturing transient interactions through covalent bonds before analysis. Bacterial two-hybrid or split-protein complementation assays offer genetic validation of interactions identified through biochemical methods.

To understand the functional significance of these interactions, researchers should conduct site-directed mutagenesis of putative interaction interfaces followed by functional assays measuring electron transport activity. Blue native polyacrylamide gel electrophoresis (BN-PAGE) can resolve intact protein complexes to assess the impact of mutations on complex assembly. Finally, cryo-electron microscopy (cryo-EM) of the purified RnfE-containing complex would provide structural insights into the organization and stoichiometry of protein-protein interactions within the complete electron transport complex.

How might RnfE function be exploited in the development of novel detection methods for Salmonella newport in food safety applications?

The exploitation of RnfE function for developing novel Salmonella newport detection methods represents an emerging opportunity in food safety applications. Researchers should explore the development of RnfE-specific aptamers or antibodies with high specificity for Salmonella newport variants of the protein. These recognition elements could be incorporated into biosensor platforms such as electrochemical impedance spectroscopy (EIS) or surface plasmon resonance (SPR) for rapid, sensitive detection.

Functional assays measuring electron transport activity specific to RnfE could be adapted into colorimetric or fluorometric detection systems suitable for field use. This approach would leverage the native biological activity rather than simply detecting the protein's presence. CRISPR-based detection systems targeting the rnfE gene could be developed, similar to how CRISPR-MVLST has been successfully applied to subtype Salmonella Newport isolates with high discriminatory ability (>0.95) .

Researchers should investigate the potential for developing metabolic fingerprinting approaches that detect specific metabolic signatures associated with RnfE activity in Salmonella newport. Such approaches could offer advantages in distinguishing viable from non-viable bacteria. For implementation in food safety settings, these detection methods should be validated using complex food matrices containing natural microbiota, similar to how the PolyFermS model has been used to test antimicrobial compounds under complex biological conditions .

What are the implications of RnfE structural variations across different Salmonella newport strains for antimicrobial resistance?

Homology modeling or experimental structure determination of different RnfE variants would allow visualization of how amino acid substitutions affect protein structure and potentially alter interactions with antimicrobial compounds. Functional characterization of these variants using electron transport assays would determine whether structural differences translate to altered protein activity or stability.

To directly assess the impact on antimicrobial susceptibility, researchers should express different RnfE variants in a common genetic background and evaluate minimum inhibitory concentrations (MICs) against various antimicrobial agents, particularly those targeting membrane integrity or energy metabolism. Similar to the approach used in studying Microcin J25 activity against Salmonella Newport, researchers should implement in vitro continuous fermentation models like PolyFermS to simulate physiologically relevant conditions when testing antimicrobial efficacy against different RnfE variants .

Long-term evolution experiments exposing S. Newport to sublethal concentrations of antimicrobials would reveal whether specific mutations in rnfE emerge consistently, providing evidence for their role in resistance development. The methodology used in CRISPR-MVLST subtyping studies could be adapted to track the spread of particular RnfE variants in clinical and agricultural settings, helping to monitor the emergence and transmission of potentially resistant strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.