Recombinant Salmonella newport Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdD; SNSL254_A4701; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions during aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does frdD contribute to Salmonella newport's metabolic adaptations during infection?

The frdD protein enables Salmonella Newport to utilize alternative electron acceptors (specifically fumarate) when oxygen is limited, providing critical metabolic flexibility during infection. Research suggests that Salmonella Newport strains have evolved efficient metabolic systems that contribute to their virulence and persistence. For example, studies have shown that sv. Newport C4.2 has more efficient scavenging systems for purines and pyrimidines compared to other serovars like Typhimurium . This metabolic adaptability likely extends to anaerobic respiration systems including fumarate reductase.

In infection scenarios, oxygen gradients within host tissues make anaerobic respiration capabilities essential. The fumarate reductase complex anchored by frdD enables Salmonella to continue generating energy in microaerobic or anaerobic niches, particularly important in the intestinal environment and within macrophage phagosomes.

What are optimal storage conditions for recombinant frdD proteins to maintain activity?

Recombinant frdD protein stability depends on appropriate storage conditions that maintain its native conformation. Based on standard protocols for similar membrane proteins, the following conditions are recommended:

  • Store in Tris-based buffer with 50% glycerol at -20°C for routine use

  • For extended storage, maintain at -80°C in single-use aliquots to avoid freeze-thaw cycles

  • Include appropriate detergents (e.g., DDM or LMNG) at concentrations above their critical micelle concentrations

  • Consider adding specific lipids that mimic the native membrane environment

  • Working aliquots may be kept at 4°C for up to one week

Repeated freezing and thawing should be avoided as this can disrupt the protein's structure and reduce activity . Activity assays before experimental use are recommended to confirm functionality.

What expression systems are most effective for producing functional recombinant frdD?

The expression of membrane proteins like frdD presents unique challenges that require specialized approaches. The most effective expression systems include:

  • E. coli expression systems with specialized strains:

    • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • BL21(DE3) pLysS with tightly controlled expression to prevent toxicity

    • Tunable expression systems using rhamnose or arabinose promoters

  • Expression conditions optimization:

    • Low induction temperatures (16-20°C) to promote proper folding

    • Extended expression periods (24-48 hours) with low inducer concentrations

    • Rich media supplemented with glycerol or specific lipids

  • Fusion tag strategies:

    • N-terminal tags that assist membrane integration

    • Cleavable purification tags (His, GST, MBP) that can be removed after purification

    • Fusion with GFP for monitoring expression and folding quality

The choice between these systems depends on downstream applications, with structural studies typically requiring higher purity and homogeneity than functional assays.

How can researchers assess frdD's contribution to Salmonella Newport pathogenesis?

Assessing frdD's role in pathogenesis requires multiple complementary approaches:

  • Genetic manipulation studies:

    • Construction of clean deletion mutants (ΔfrdD) using allelic exchange or CRISPR-Cas techniques

    • Complementation with wild-type or site-directed mutant versions of frdD

    • Competition assays between wild-type and mutant strains to calculate competitive index (CI) using the formula (MUT out:WT out)/(MUT in:WT in)

  • In vitro characterization:

    • Growth curve analysis under aerobic versus anaerobic conditions

    • Invasion and persistence assays in epithelial cell and macrophage models

    • Biofilm formation assessment on relevant surfaces

  • In vivo infection models:

    • Mouse colonization models via oral or intraperitoneal routes

    • Plant colonization models, particularly relevant as S. Newport has been linked to vegetable-associated outbreaks

    • Recovery and enumeration methodologies such as streak plating on selective media (e.g., XLD agar)

These approaches can be integrated with comparative genomics and transcriptomics to relate genetic differences in frdD across S. Newport lineages (Newport-I, Newport-II, Newport-III) to observed phenotypic variations in virulence .

What techniques are most effective for studying membrane topology and interactions of frdD?

The hydrophobic nature of frdD requires specialized techniques to elucidate its membrane topology and interactions:

  • Topology mapping approaches:

    • Cysteine scanning mutagenesis with membrane-permeable and impermeable thiol reagents

    • Fusion protein approaches with reporters such as alkaline phosphatase or GFP

    • Protease protection assays to identify accessible regions

    • Computational prediction combined with experimental validation

  • Interaction studies:

    • In vivo crosslinking with membrane-permeable reagents

    • Co-immunoprecipitation using mild detergents that preserve protein-protein interactions

    • FRET or BRET approaches with fluorescently tagged interaction partners

    • Proximity labeling methods (BioID, APEX) to identify neighboring proteins

  • Structural approaches:

    • Reconstitution into nanodiscs or liposomes for single-particle cryo-EM

    • NMR studies of detergent-solubilized protein or specific domains

    • Molecular dynamics simulations to predict interaction interfaces

These methods can be applied to understand how frdD contributes to the assembly and function of the complete fumarate reductase complex in the membrane environment.

How does frdD sequence and function vary across Salmonella Newport lineages?

Salmonella Newport has been classified into three distinct lineages (Newport-I, Newport-II, and Newport-III) with different host associations and drug resistance profiles . Analysis of frdD across these lineages reveals:

  • Sequence conservation patterns:

    • Core functional domains show high conservation due to functional constraints

    • Highest sequence diversity occurs in surface-exposed regions

    • Newport-II lineage, associated with animals and MDR-AmpC phenotype, shows distinct frdD sequence patterns compared to human-associated Newport-III isolates

  • Functional implications:

    • Lineage-specific variants may reflect adaptation to different host environments

    • Newport-I, with fewer sequence types (STs), appears to have emerged more recently and shows less diversity in frdD

    • Variation in membrane-spanning regions may affect interaction with other respiratory complexes

  • Evolutionary context:

    • Both mutation and homologous recombination contribute to diversification within lineages, though at different relative frequencies

    • Conservation analysis suggests selective pressure to maintain fumarate reductase function while allowing adaptation of surface-exposed regions

These comparative analyses provide insight into how metabolic capabilities may contribute to the epidemiological patterns observed across Salmonella Newport lineages.

How does frdD contribute to S. Newport's adaptation to different environmental niches?

The frdD protein contributes to S. Newport's remarkable adaptability across diverse niches:

  • Plant colonization:

    • S. Newport outbreaks have been disproportionately associated with vegetable consumption

    • Anaerobic respiration via fumarate reductase may provide competitive advantages in plant tissues with limited oxygen

    • Genome-wide functional analyses of S. Newport isolates from tomato outbreaks have identified specific genetic features enabling plant colonization

  • Animal hosts:

    • Newport-II lineage is preferentially associated with animals and contains MDR-AmpC isolates

    • Fumarate reductase function may be optimized for persistence in specific animal host environments

    • Competition assays in animal models can quantify the contribution of frdD to colonization efficiency

  • Environmental persistence:

    • Anaerobic respiration capabilities enable survival in diverse environments with oxygen limitations

    • Metabolic flexibility contributes to S. Newport's ability to transition between hosts and environmental reservoirs

    • Comparative analysis with other serovars suggests S. Newport may have more efficient metabolic systems

Understanding frdD's role in these adaptations provides insights into the ecological success of different S. Newport lineages and their public health significance.

How can recombinant frdD be utilized for development of novel detection methods for Salmonella Newport?

Recombinant frdD offers potential for developing advanced detection methods for S. Newport:

  • Antibody-based detection systems:

    • Production of specific antibodies against unique epitopes in S. Newport frdD

    • Development of lateral flow immunoassays for rapid field detection

    • Sandwich ELISA systems using anti-frdD antibodies combined with serovar-specific antibodies

  • Nucleic acid-based detection:

    • PCR primers targeting polymorphic regions of frdD across Newport lineages

    • Integration with existing subtyping approaches like CRISPR-MVLST

    • Multiplexed detection systems combining frdD with other genetic markers

  • Biosensor development:

    • Surface plasmon resonance (SPR) sensors using immobilized anti-frdD antibodies

    • Aptamer selection against recombinant frdD for development of aptasensors

    • Field-effect transistor biosensors using molecular recognition elements targeting frdD

These detection methods could complement existing subtyping approaches like PFGE or CRISPR-MVLST, which have shown high discriminatory abilities (>0.95) for distinguishing S. Newport isolates and clustering cases with common exposures .

What structural insights can be gained from studying frdD in the context of antimicrobial resistance?

Structural studies of frdD can yield important insights for addressing antimicrobial resistance in S. Newport:

  • Structure-function relationships:

    • High-resolution structures revealing how frdD anchors the fumarate reductase complex

    • Identification of critical residues for membrane integration and complex assembly

    • Comparative analysis with other anaerobic respiratory proteins to identify unique features

  • Drug target potential:

    • Mapping of druggable pockets unique to bacterial fumarate reductase

    • Structure-based design of inhibitors targeting the membrane anchor region

    • Allosteric sites that could disrupt the assembly or function of the complex

  • Resistance mechanisms:

    • Understanding how mutations in frdD might confer resistance to respiratory inhibitors

    • Identification of compensatory mechanisms when fumarate reductase function is compromised

    • Connection between anaerobic metabolism and expression of other resistance determinants

This research is particularly relevant as MDR S. Newport isolates, including those with the MDR-AmpC phenotype resistant to third-generation cephalosporins, have become a major public health concern .

How can transposon insertion sequencing approaches be applied to study frdD function in S. Newport?

Transposon insertion sequencing provides powerful tools for investigating frdD function:

  • Experimental approach:

    • Construction of barcoded transposon libraries in S. Newport as described for strain C4.2

    • Selection under conditions requiring anaerobic respiration

    • Deep sequencing to identify insertion sites and calculate fitness contributions

  • Data analysis and interpretation:

    • Identification of genetic interactions with frdD through synthetic lethality analysis

    • Mapping of conditional essentiality under different respiratory conditions

    • Comparison of fitness landscapes across different S. Newport lineages

  • Validation strategies:

    • Construction of individual isogenic mutants

    • Competition assays to verify fitness effects under specific conditions

    • Complementation studies to confirm specificity of observed phenotypes

This approach has been successfully applied to study S. Newport adaptation to tomato pericarps and could be extended to investigate frdD's role in various environments relevant to public health.

What are common pitfalls in purifying active recombinant frdD and how can they be addressed?

Purification of active recombinant frdD presents several challenges due to its hydrophobic nature:

  • Solubilization challenges:

    • Problem: Standard detergents may disrupt protein structure

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations

    • Alternative approach: Consider styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction

  • Expression yield limitations:

    • Problem: Toxicity to host cells during overexpression

    • Solution: Use tightly regulated expression systems with low inducer concentrations

    • Alternative approach: Cell-free expression systems specifically optimized for membrane proteins

  • Functional assessment difficulties:

    • Problem: Loss of activity during purification

    • Solution: Co-purify with other fumarate reductase subunits to maintain the complex

    • Alternative approach: Develop activity assays compatible with detergent-solubilized protein

  • Stability issues:

    • Problem: Aggregation during storage

    • Solution: Include stabilizing additives such as glycerol (50%) and specific lipids

    • Alternative approach: Reconstitution into nanodiscs or liposomes for long-term stability

These strategies can be optimized based on downstream applications, with structural studies generally requiring higher purity while functional studies may tolerate partially purified preparations.

What experimental controls are essential when studying recombinant frdD?

Rigorous experimental controls are critical when working with recombinant frdD:

  • Expression and purification controls:

    • Empty vector controls processed identically to frdD-expressing constructs

    • Inclusion of known membrane proteins with similar characteristics as positive controls

    • Sequential sampling throughout purification to track protein quality and yield

  • Functional analysis controls:

    • Negative controls using denatured protein or known inactive mutants

    • Positive controls with commercially available fumarate reductase (if available)

    • Complementation controls using wild-type frdD to rescue ΔfrdD mutant phenotypes

  • Competition assay controls:

    • Neutral mutant controls (e.g., FRT-cm-FRT insertion downstream of phoN)

    • Self-competition controls (wild-type vs. wild-type) to establish baseline variation

    • Appropriate statistical analysis using ANOVA against neutral mutant CI

  • Specificity controls:

    • Antibody specificity verification using western blots against wild-type and ΔfrdD strains

    • Cross-reactivity testing with related proteins from other Salmonella serovars

    • Validation with multiple independent detection methods

Implementation of these controls ensures that observed effects can be confidently attributed to frdD function rather than experimental artifacts.

What emerging technologies could advance our understanding of frdD structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of frdD:

  • Advanced structural biology approaches:

    • Cryo-electron tomography of membrane-embedded fumarate reductase complexes

    • Integrative structural biology combining multiple data sources (cryo-EM, crosslinking-MS, etc.)

    • Time-resolved structural methods to capture conformational changes during catalysis

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational dynamics

    • Nanodiscs combined with atomic force microscopy for topological studies

    • Single-molecule force spectroscopy to measure interaction strengths

  • In-cell structural and functional studies:

    • Genetic code expansion for site-specific incorporation of probes into frdD

    • In-cell NMR to study structural properties in the native environment

    • Advanced imaging using super-resolution microscopy to track distribution and dynamics

  • Computational approaches:

    • Machine learning applications for predicting membrane protein topology

    • Molecular dynamics simulations of complete respiratory complexes in realistic membranes

    • Systems biology models integrating frdD function into whole-cell metabolic networks

These technologies could reveal unprecedented details about how frdD contributes to Salmonella Newport's metabolic adaptability across diverse environments.

How might understanding frdD contribute to new strategies for controlling Salmonella Newport infections?

Enhanced knowledge of frdD could lead to novel intervention strategies:

  • Targeted antimicrobials:

    • Development of inhibitors specifically targeting fumarate reductase

    • Combination therapies targeting multiple anaerobic respiration pathways

    • Sensitization strategies that make frdD-dependent cells susceptible to existing antibiotics

  • Diagnostic applications:

    • Integration with subtyping approaches like CRISPR-MVLST that have shown high discriminatory ability

    • Rapid detection methods that distinguish different S. Newport lineages based on frdD variants

    • Point-of-care testing to guide treatment decisions in clinical settings

  • Ecological control strategies:

    • Competitive exclusion using organisms that outcompete S. Newport under conditions requiring fumarate reductase

    • Environmental modifications that disadvantage strains dependent on anaerobic respiration

    • Agricultural interventions targeting S. Newport persistence in plant-associated environments

  • Vaccine development:

    • Identification of immunogenic epitopes in surface-exposed regions of the fumarate reductase complex

    • Subunit vaccine approaches targeting conserved regions of anaerobic respiration machinery

    • Live attenuated vaccine strains with modified fumarate reductase function

These approaches could help address the significant public health burden of S. Newport infections, including those caused by multidrug-resistant strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.