Recombinant Salmonella newport Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Salmonella Newport Glycerol-3-Phosphate Acyltransferase (PlsY) is a bacterial enzyme critical for phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acyl-acyl carrier protein (acyl-ACP) to the sn-1 position of glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), a key precursor for membrane phospholipids . The recombinant form is produced in Escherichia coli with an N-terminal His tag for purification .

Production and Purification

ParameterSpecification
Expression SystemE. coli
TagN-terminal His
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage-20°C/-80°C in Tris/PBS buffer (6% trehalose, pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Catalytic Mechanism

PlsY utilizes acyl-ACP as the acyl donor, distinguishing it from eukaryotic acyltransferases that use acyl-CoA . This step is rate-limiting in bacterial phospholipid synthesis, making PlsY a regulatory checkpoint for membrane biogenesis .

Role in Salmonella Physiology

  • Membrane Integrity: Essential for forming the lipid bilayer, influencing virulence and antibiotic resistance .

  • Metabolic Adaptation: Enables utilization of glycerol-3-phosphate as a carbon source under phosphate-limiting conditions .

Key Studies

  • Drug Target Validation: PlsY’s role in lipid biosynthesis makes it a candidate for antimicrobial development .

  • Structural Biology: Used in crystallography to study acyltransferase mechanisms .

  • Pathogenicity Studies: Linked to Salmonella Newport’s ability to persist in host environments .

Comparative Analysis

FeatureS. Newport PlsY S. Gallinarum PlsY
Amino Acid SequenceIdentical (100%)Identical (100%)
UniProt IDB4T677B5REG5
Host AssociationBroad (humans, animals)Poultry-specific

Industrial and Clinical Relevance

  • Biochemical Assays: Used to screen inhibitors targeting bacterial lipid metabolism .

  • Antibiotic Resistance: MDR Salmonella Newport strains (e.g., Lineage-II) exhibit conserved PlsY sequences, suggesting evolutionary stability .

Future Directions

  • Stress Response: Investigate PlsY’s role in Salmonella Newport’s transition to a viable-but-non-culturable (VBNC) state under disinfectant stress .

  • Membrane Dynamics: Study PlsY activity in amphiphilic environments to mimic host-pathogen interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to fulfill any specific format requirements you may have. Please indicate your desired format in the order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is dependent on several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; ygiH; SNSL254_A3467; Glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
plsY
Target Protein Sequence
MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLI FDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGW DLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Although it can utilize acyl-CoA as a fatty acyl donor, it does not utilize acyl-PO(4).
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Salmonella Newport Glycerol-3-phosphate acyltransferase (PlsY)?

Salmonella Newport Glycerol-3-phosphate acyltransferase (PlsY) is a membrane-bound enzyme that catalyzes the transfer of acyl groups to glycerol-3-phosphate, a crucial step in phospholipid biosynthesis. The full-length protein consists of 203 amino acids and belongs to the acyltransferase family . The protein contains hydrophobic transmembrane domains that anchor it to the bacterial membrane, with its active site oriented to facilitate the transfer of fatty acyl groups.

Structurally, PlsY belongs to the membrane-bound acyltransferase family similar to the Acyltransferase_3 (AT3) domain-containing proteins found across bacterial species. These proteins typically consist of multiple transmembrane helices forming a hydrophobic core through which the substrate can access the active site .

How does PlsY differ from other acyltransferases in Salmonella species?

While PlsY (Glycerol-3-phosphate acyltransferase) is primarily involved in phospholipid biosynthesis, other acyltransferases in Salmonella serve different functions. For example, OafA and OafB, which contain both AT3 and SGNH domains, are specifically involved in O-antigen acetylation in the lipopolysaccharide (LPS) structure .

The key differences include:

AcyltransferasePrimary FunctionDomain StructureSubstrate Specificity
PlsYPhospholipid biosynthesisAT3 domainGlycerol-3-phosphate
OafAO-antigen acetylationAT3-SGNH fused domainsSpecific O-antigen residues
OafBO-antigen acetylationAT3-SGNH fused domainsDifferent O-antigen residues than OafA

Unlike OafA and OafB, PlsY does not have a fused SGNH domain, which is responsible for the final step of acetyl group transport to carbohydrate acceptors in those proteins .

What are the conserved amino acid sequences in Salmonella Newport PlsY that are critical for enzymatic activity?

The amino acid sequence of Salmonella Newport PlsY contains several conserved regions essential for its enzymatic function. The full sequence (MSAIAPGMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGATNVLRIGGKGAAVAVLIFDILKGMLPVWGAYALGVTPFWLGLIAIAACLGHIWPVFFGFKGGKGVATAFGAIAPIGWDLTGVMAGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVSMLSCLILLRHHDN IQRLWRRQETKIWTKLKKKRQKD) includes critical residues involved in substrate binding and catalysis .

Key functional residues include:

  • Conserved histidine residues in transmembrane domains that may participate in the acyl transfer mechanism

  • Hydrophobic residues forming the substrate binding pocket

  • Charged residues at the cytoplasmic interface that likely interact with the phosphate group of glycerol-3-phosphate

Mutational studies of homologous acyltransferases have shown that altering these conserved residues significantly impairs enzymatic activity.

What are the optimal conditions for expressing recombinant Salmonella Newport PlsY in E. coli?

For optimal expression of recombinant Salmonella Newport PlsY in E. coli, researchers should consider the following protocol:

  • Expression System Selection: Use E. coli BL21(DE3) strain for high-level expression of the His-tagged protein .

  • Vector Design: Clone the full-length plsY gene (encoding amino acids 1-203) into an expression vector with an N-terminal His-tag for purification purposes .

  • Culture Conditions:

    • Medium: LB broth supplemented with appropriate antibiotics

    • Temperature: Initial growth at 37°C until OD600 reaches 0.6-0.8, followed by induction at lower temperature (16-25°C)

    • Induction: 0.1-0.5 mM IPTG for 4-18 hours

    • Aeration: Maintain proper aeration with vigorous shaking (200-250 rpm)

  • Membrane Protein Considerations: Since PlsY is a membrane protein, consider adding mild detergents (0.1-1% DDM or LDAO) during lysis and purification to maintain protein solubility and function.

  • Purification Strategy: Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin, followed by size exclusion chromatography to obtain purified protein .

The recombinant protein can be reconstituted in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for storage and subsequent experiments .

What are the most effective methods for measuring PlsY enzymatic activity in vitro?

Several approaches can be employed to measure PlsY enzymatic activity in vitro, each with specific advantages:

  • Radioisotope-Based Assay:

    • Principle: Measure the transfer of radiolabeled acyl groups (14C or 3H-labeled acyl-ACP or acyl-CoA) to glycerol-3-phosphate

    • Procedure: Incubate purified PlsY with radiolabeled acyl donors and glycerol-3-phosphate in an appropriate buffer, then quantify radiolabeled product formation

    • Advantage: High sensitivity and specificity

  • Coupled Enzyme Assay:

    • Principle: Link PlsY activity to reactions that produce measurable products (e.g., NADH or NADPH consumption)

    • Procedure: Couple the PlsY reaction to auxiliary enzymes that generate spectrophotometrically detectable changes

    • Advantage: Real-time continuous monitoring of activity

  • LC-MS Based Assay:

    • Principle: Direct detection and quantification of reaction products

    • Procedure: Incubate PlsY with substrates, extract lipid products, and analyze by LC-MS

    • Advantage: High specificity and ability to detect multiple reaction products

For accurate assessment, reconstitute purified PlsY in phospholipid liposomes or nanodiscs to mimic its native membrane environment, as the membrane context significantly affects activity of this integral membrane enzyme.

How can researchers effectively purify Salmonella Newport PlsY while maintaining its structural integrity?

Purifying membrane proteins like PlsY presents significant challenges. Here's a comprehensive approach to maintain structural integrity throughout the purification process:

  • Cell Lysis and Membrane Isolation:

    • Resuspend E. coli cells expressing PlsY in buffer containing protease inhibitors

    • Lyse cells using mechanical disruption (e.g., sonication or French press)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

  • Membrane Protein Solubilization:

    • Solubilize membrane pellet in buffer containing appropriate detergents:

      • Primary options: n-Dodecyl β-D-maltoside (DDM, 1%), Lauryl maltose neopentyl glycol (LMNG, 0.5-1%)

      • Alternative options: Digitonin (1-2%) or LDAO (0.5-1%)

    • Incubate with gentle agitation at 4°C for 1-2 hours

    • Remove insoluble material by ultracentrifugation

  • Affinity Purification:

    • Apply solubilized protein to Ni-NTA resin pre-equilibrated with solubilization buffer containing lower detergent concentration

    • Wash extensively to remove non-specifically bound proteins

    • Elute with imidazole gradient (50-500 mM)

  • Further Purification:

    • Perform size exclusion chromatography using a Superdex 200 column equilibrated with buffer containing detergent above critical micelle concentration

    • Consider ion exchange chromatography as an additional purification step

  • Detergent Exchange or Removal:

    • For functional studies: Exchange into milder detergents or lipid nanodiscs

    • For structural studies: Consider reconstitution into amphipols or lipidic cubic phase

  • Storage Considerations:

    • Store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

  • Quality Control:

    • Assess purity by SDS-PAGE (>90% purity is desirable)

    • Verify structural integrity by circular dichroism or thermal shift assays

    • Confirm activity using enzymatic assays described in section 2.2

How does PlsY contribute to Salmonella Newport virulence and pathogenesis?

Glycerol-3-phosphate acyltransferase (PlsY) plays a significant, though often overlooked, role in Salmonella Newport virulence through several mechanisms:

  • Membrane Phospholipid Biosynthesis: As a key enzyme in phospholipid biosynthesis, PlsY is essential for bacterial membrane integrity and function. Proper membrane structure is critical for adhesion to host cells, resistance to host defense mechanisms, and functioning of bacterial secretion systems .

  • Metabolic Adaptation During Infection: During infection, Salmonella must adapt its metabolism to the host environment. PlsY is involved in phospholipid remodeling in response to environmental stresses encountered within the host, potentially contributing to bacterial survival within macrophages.

  • Connection to Virulence Regulation: While not directly involved in virulence factor production, phospholipid biosynthesis pathways can indirectly affect the expression of virulence genes through membrane signaling systems.

  • Potential Link to Antibiotic Resistance: The membrane composition, influenced by PlsY activity, can affect bacterial susceptibility to certain antibiotics. Multidrug-resistant Salmonella Newport strains, such as those with MDR-AmpC phenotype described in the literature, may have altered membrane compositions that contribute to their resistance profiles .

  • Vaccine Development Implications: Understanding PlsY function has implications for live attenuated vaccine development. For example, the live attenuated Salmonella Newport vaccine strain CVD 1979 (with deletions in guaBA, htrA, and aroA genes) has been developed to elicit protective immune responses . While PlsY itself is not typically targeted for attenuation, its activity and the resulting membrane composition may affect vaccine strain performance.

It is worth noting that virulence factors and bacterial membrane integrity are closely interconnected in bacterial pathogenesis, with phospholipid biosynthesis enzymes like PlsY playing fundamental roles in maintaining proper bacterial physiology during infection.

What role does PlsY play in Salmonella Newport antibiotic resistance mechanisms?

PlsY's contribution to antibiotic resistance in Salmonella Newport is multifaceted and occurs through several direct and indirect mechanisms:

  • Membrane Permeability Modulation: As a key enzyme in phospholipid biosynthesis, PlsY influences membrane composition and permeability, which directly affects the ability of antibiotics to penetrate the bacterial cell. Alterations in membrane phospholipid content can create a more impermeable barrier to certain antibiotics, particularly hydrophilic ones .

  • Interaction with Efflux Systems: The phospholipid environment created through PlsY activity can impact the assembly and function of multidrug efflux pumps, which are major contributors to antimicrobial resistance in Salmonella. Proper membrane composition is essential for optimal functioning of these transmembrane protein complexes.

  • Association with MDR Phenotypes: Multidrug-resistant Salmonella Newport strains, particularly those with the MDR-AmpC phenotype, show resistance to multiple antibiotics including ampicillin, chloramphenicol, streptomycin, sulfamethoxazole, and tetracycline . While PlsY is not directly responsible for conferring these resistance traits, its proper function is necessary for expressing the resistance phenotype by maintaining membrane integrity.

  • Metabolic Adaptations Under Antibiotic Stress: When exposed to antibiotics, Salmonella can undergo metabolic adaptations that include changes in phospholipid biosynthesis. PlsY activity may be modulated as part of these stress responses, potentially contributing to tolerance or persistence during antibiotic treatment.

  • Potential for Novel Therapeutic Targeting: The essential nature of PlsY makes it a potential target for novel antimicrobial development. Inhibitors of PlsY could potentially sensitize resistant Salmonella Newport to existing antibiotics by disrupting membrane integrity or bacterial metabolism.

It's important to note that while the direct role of PlsY in antibiotic resistance is primarily through membrane effects, this enzyme is part of the complex network of factors that collectively contribute to the increasingly concerning multidrug resistance observed in Salmonella Newport isolates from both clinical and agricultural settings .

How does PlsY activity correlate with Salmonella Newport adaptation to different host environments?

PlsY plays a critical role in Salmonella Newport's adaptation to diverse host environments through its function in phospholipid biosynthesis. This adaptability is essential for the pathogen's success in colonizing different hosts, from humans to various food animals.

  • Membrane Fluidity Regulation: Different host environments present varying temperature, pH, and osmotic conditions. PlsY activity contributes to adaptive changes in membrane fluidity by modifying phospholipid composition in response to these environmental factors . For example:

    • In warmer mammalian hosts (37°C): PlsY may incorporate specific fatty acids that maintain appropriate membrane fluidity

    • In colder environments: Different fatty acid incorporation patterns help maintain membrane function at lower temperatures

  • Host-Specific Nutrient Adaptation: Different host niches offer varying availability of fatty acids and precursors. PlsY allows Salmonella to utilize available acyl donors efficiently:

    Host EnvironmentAvailable PrecursorsPlsY Adaptation
    Intestinal lumenShort-chain fatty acidsUtilization for phospholipid synthesis
    Intracellular (macrophages)Limited fatty acid availabilityScavenging and efficient utilization
    Food-animal hosts (various)Host-specific fatty acid profilesAdaptation to available acyl donors
  • Cross-Species Transmission: Salmonella Newport is notable for its ability to infect multiple host species. Research suggests that its transmissibility between food-animal reservoirs involves membrane adaptations that may be influenced by PlsY activity . The multi-host adaptability of Salmonella Newport makes it a significant concern in both human health and agricultural settings.

  • Stress Response Integration: PlsY activity is integrated with bacterial stress responses. During host colonization, Salmonella encounters various stressors including:

    • Antimicrobial peptides

    • Bile salts

    • Acidic pH

    • Nutrient limitation

    • Immune cell attack

    PlsY-mediated phospholipid modifications contribute to resistance against these stresses by maintaining membrane integrity and function.

  • Biofilm Formation: In some host environments, Salmonella forms biofilms that enhance persistence. Phospholipid composition influences bacterial surface properties that affect attachment and biofilm development, with PlsY playing a contributory role in this process.

Understanding how PlsY facilitates adaptation to different hosts has implications for controlling Salmonella Newport transmission through the food chain and for developing intervention strategies that target this adaptability .

How can researchers effectively use recombinant PlsY to study Salmonella Newport lipid metabolism pathways?

Recombinant PlsY serves as a powerful tool for investigating Salmonella Newport lipid metabolism through several strategic approaches:

This multifaceted approach using recombinant PlsY allows for detailed investigation of lipid metabolism pathways that would be difficult to study in the context of the whole organism, particularly given the essential nature of these pathways for bacterial viability.

What technical challenges are associated with structural studies of Salmonella Newport PlsY, and how can they be overcome?

Structural characterization of Salmonella Newport PlsY presents several significant challenges due to its nature as an integral membrane protein. Here are the key challenges and strategies to address them:

  • Protein Expression and Purification Challenges:

    ChallengeSolution Strategy
    Low expression levelsOptimize codon usage for E. coli; use specialized expression strains (C41/C43); employ strong inducible promoters with fine-tuned induction
    Toxicity to expression hostUse tight expression control with leaky-free promoters; employ Lemo21(DE3) or other tunable expression systems
    Protein aggregationInclude stabilizing additives (glycerol, specific lipids); optimize buffer conditions; use fusion partners like MBP or SUMO
    Maintaining native conformationScreen multiple detergents systematically; consider styrene-maleic acid lipid particles (SMALPs) or nanodiscs for detergent-free extraction
  • Crystallization Barriers:

    • Challenge: Limited polar surface area for crystal contacts

    • Solutions:

      • Employ antibody fragments (Fabs) or nanobodies to increase polar surface area

      • Use lipidic cubic phase (LCP) crystallization techniques specifically designed for membrane proteins

      • Consider fusion with crystallization chaperones like T4 lysozyme or BRIL

      • Implement surface entropy reduction mutations to promote crystal lattice formation

  • Cryo-EM Considerations:

    • Challenge: Small size of PlsY (~23 kDa) is below typical detection limits for single-particle cryo-EM

    • Solutions:

      • Use larger scaffold proteins or antibody complexes to increase molecular weight

      • Employ megabody or other size-enhancing binding partners

      • Consider electron crystallography of 2D crystals as an alternative approach

      • Utilize advances in Volta phase plates and direct electron detectors that improve resolution for smaller proteins

  • NMR Spectroscopy Approaches:

    • Challenge: Size and detergent micelle complicate traditional NMR approaches

    • Solutions:

      • Employ selective isotope labeling strategies

      • Use TROSY-based pulse sequences optimized for membrane proteins

      • Consider solid-state NMR of reconstituted PlsY in lipid bilayers

      • Focus on specific domains or regions rather than the entire protein

  • Computational Considerations:

    • Challenge: Limited templates for homology modeling

    • Solutions:

      • Utilize advanced AI-based structure prediction tools (AlphaFold2, RoseTTAFold)

      • Validate computational models with sparse experimental constraints

      • Employ molecular dynamics simulations in explicit membrane environments to refine models

  • Functional State Capture:

    • Challenge: Obtaining structures in different functional states

    • Solutions:

      • Use non-hydrolyzable substrate analogs or transition state mimics

      • Engineer point mutations that trap specific conformational states

      • Consider time-resolved structural approaches to capture reaction intermediates

By systematically addressing these challenges through integration of multiple approaches, researchers can work toward solving the structure of Salmonella Newport PlsY, which would significantly advance our understanding of its catalytic mechanism and potential for therapeutic targeting.

How can CRISPR-Cas9 technology be leveraged to study PlsY function in Salmonella Newport?

CRISPR-Cas9 technology offers powerful approaches for investigating PlsY function in Salmonella Newport, enabling precise genetic manipulation that was previously challenging in this pathogen. Here's a comprehensive framework for utilizing CRISPR-Cas9 to study this essential enzyme:

  • Conditional Knockdown/Knockout Strategies:

    • Challenge: PlsY is likely essential, making complete knockouts lethal

    • Solutions:

      • Deploy CRISPRi (CRISPR interference) with dCas9 for tunable repression of plsY expression

      • Establish inducible CRISPR systems using anhydrotetracycline (aTc) or arabinose-controlled promoters

      • Create conditional knockouts using temperature-sensitive plasmid systems or inducible promoter replacements

      • Design sRNA-based approaches for post-transcriptional regulation of PlsY expression

  • Domain Mapping and Functional Analysis:

    • Create precise in-frame deletions or mutations targeting specific functional domains

    • Introduce point mutations in predicted catalytic residues to create enzymatically inactive variants

    • Incorporate epitope tags for tracking protein localization and interaction studies

    • Engineer chimeric proteins by swapping domains with homologous enzymes from other species

  • Regulation Studies:

    • Use CRISPR-based tools to modify promoter regions to understand transcriptional regulation

    • Create reporter constructs to monitor plsY expression under different environmental conditions

    • Identify and modify potential regulatory elements using targeted mutations

    • Implement CRISPRa (CRISPR activation) to upregulate plsY expression and study the effects of overexpression

  • In Vivo Relevance Assessment:

    • Generate libraries of PlsY variants using CRISPR-based saturation mutagenesis

    • Screen libraries for altered phenotypes related to growth, membrane integrity, or stress response

    • Implement CRISPR-mediated base editing for precise nucleotide changes without double-strand breaks

    • Use CRISPR interference during infection models to assess PlsY's role in pathogenesis

  • Experimental Design Considerations:

    Experimental ApproachTechnical ImplementationExpected Outcome
    PlsY depletion studiesInducible CRISPRi targeting plsYCharacterization of growth defects, membrane changes, and metabolic adaptations
    Structure-function analysisCRISPR-mediated point mutationsIdentification of critical residues for catalysis and substrate specificity
    Regulatory network mappingCRISPR screens targeting potential regulatorsDiscovery of factors controlling plsY expression and activity
    Host-pathogen interactionCRISPRi-mediated PlsY depletion during infectionAssessment of PlsY's role in virulence and host adaptation
  • Integration with Other Approaches:

    • Combine CRISPR modifications with metabolomic profiling to link PlsY activity to global metabolic changes

    • Pair with transcriptomics to identify compensatory responses to PlsY manipulation

    • Integrate with lipidomics to characterize membrane composition changes

    • Use in conjunction with protein-protein interaction studies to map the PlsY interactome

  • Technical Optimization for Salmonella Newport:

    • Optimize sgRNA design using Salmonella-specific algorithms to maximize efficiency

    • Develop delivery systems tailored to Salmonella (electroporation protocols, specialized vectors)

    • Establish methods to overcome potential CRISPR-Cas9 toxicity in Salmonella

    • Implement strategies to avoid off-target effects, such as high-fidelity Cas9 variants

These CRISPR-Cas9 approaches can significantly advance our understanding of PlsY function in Salmonella Newport, providing insights into basic bacterial physiology, pathogenesis mechanisms, and potential therapeutic targeting strategies.

How does Salmonella Newport PlsY compare structurally and functionally to homologous enzymes in other bacterial pathogens?

Comparative analysis of Salmonella Newport PlsY reveals important similarities and distinctions when compared to homologous enzymes in other bacterial pathogens:

  • Structural Conservation and Divergence:

    PlsY belongs to the acyltransferase family and shares core structural features with homologs across bacterial species . Key comparative features include:

    FeatureSalmonella Newport PlsYOther Bacterial PlsY HomologsSignificance
    Transmembrane domains7-8 predicted TM helices6-8 TM helices (species-dependent)Conserved membrane topology across species
    Active site architectureConserved histidine and arginine residuesSimilar catalytic residues in most speciesMechanistic conservation of acyl transfer
    Substrate binding pocketAccommodates medium-chain fatty acidsVariable size affecting acyl chain preferenceAdaptation to available fatty acid pools
    Oligomerization stateLikely functions as monomerVaries from monomers to dimersPotential differences in regulation
  • Functional Conservation:

    • The fundamental role of PlsY in the first step of phospholipid biosynthesis is conserved across bacterial species

    • Essential nature of this enzyme is maintained in virtually all bacteria examined

    • Basic catalytic mechanism involving acyl transfer to glycerol-3-phosphate is preserved

  • Species-Specific Adaptations:

    • Substrate specificity varies between species, reflecting adaptation to different fatty acid availability

    • Regulatory mechanisms controlling PlsY expression and activity show species-specific patterns

    • Integration with other metabolic pathways varies between bacterial pathogens

  • Comparison with Specific Pathogens:

    • vs. E. coli PlsY: High sequence similarity (~80%) with conserved catalytic residues, but potentially different substrate preferences

    • vs. Staphylococcus aureus PlsY: Lower sequence similarity (~40%) with more significant differences in membrane topology

    • vs. Mycobacterium tuberculosis PlsY: More distant relationship with substantial differences in substrate recognition regions

  • Evolutionary Implications:

    • PlsY represents an ancient enzyme family present in most bacteria

    • The enzyme has undergone adaptive evolution to optimize function in different bacterial lifestyles

    • Sequence analysis suggests horizontal gene transfer may have occurred in some lineages

    • Conservation of PlsY across pathogenic and non-pathogenic species indicates its fundamental role in bacterial physiology

  • Functional Redundancy:

    • Unlike some bacterial species that possess multiple pathways for the initial step of phospholipid synthesis, Salmonella Newport relies primarily on PlsY

    • This lack of redundancy makes PlsY an essential enzyme and potential therapeutic target

The comparative analysis of PlsY across bacterial pathogens provides insights into both the fundamental constraints on phospholipid biosynthesis and the species-specific adaptations that may contribute to pathogen success in different ecological niches.

What insights can genomic and phylogenetic analyses provide about PlsY evolution in Salmonella Newport lineages?

Genomic and phylogenetic analyses of PlsY in Salmonella Newport lineages reveal significant evolutionary patterns that inform our understanding of both the enzyme's fundamental role and its adaptation to specific ecological niches:

These evolutionary insights highlight the fundamental tension between conservation of essential function and adaptation to specific ecological niches that has shaped PlsY evolution in Salmonella Newport lineages.

How can molecular dynamics simulations enhance our understanding of PlsY substrate interactions and catalytic mechanisms?

Molecular dynamics (MD) simulations offer powerful approaches to investigate PlsY function at the atomic level, providing insights that are difficult to obtain through experimental methods alone. Here's how MD simulations can specifically enhance our understanding of Salmonella Newport PlsY:

  • Membrane Environment Modeling:

    PlsY functions within the bacterial membrane, and MD simulations can model this complex environment with increasing accuracy:

    • Incorporation of PlsY into realistic bacterial membrane compositions

    • Simulation of lipid-protein interactions that may regulate enzyme activity

    • Investigation of how membrane composition affects protein dynamics

    • Assessment of how membrane curvature or tension influences catalytic activity

  • Substrate Binding Dynamics:

    MD simulations can reveal the detailed mechanisms of substrate recognition and binding:

    • Characterization of binding pathways for glycerol-3-phosphate and acyl donors

    • Identification of transient binding sites not visible in static structural models

    • Quantification of binding energetics through free energy calculations

    • Elucidation of the order of substrate binding in the catalytic cycle

  • Catalytic Mechanism Elucidation:

    Advanced simulation techniques can model the chemical reactions catalyzed by PlsY:

    • QM/MM (quantum mechanics/molecular mechanics) approaches to model bond formation/breaking

    • Identification of transition states and reaction intermediates

    • Calculation of energy barriers for catalytic steps

    • Investigation of proton transfer pathways in the active site

  • Water and Ion Dynamics:

    The role of water molecules and ions in PlsY function can be explored:

    • Identification of conserved water molecules in the active site

    • Characterization of ion binding sites that may regulate activity

    • Investigation of water access channels to the membrane-embedded active site

    • Assessment of how hydration affects substrate specificity

  • Conformational Dynamics and Allostery:

    PlsY likely undergoes conformational changes during its catalytic cycle:

    • Identification of major conformational states (open, closed, intermediate)

    • Characterization of the conformational landscape using enhanced sampling techniques

    • Investigation of potential allosteric sites that may regulate activity

    • Analysis of how mutations might affect conformational dynamics

  • Specific Simulation Approaches for PlsY:

    Simulation TechniqueApplication to PlsYExpected Insight
    Equilibrium MDBasic protein dynamics in membraneConformational flexibility, lipid interactions
    Steered MDSubstrate approach and product releaseEnergy barriers for substrate entry/exit
    Umbrella samplingFree energy profiles for substrate bindingQuantitative binding affinities
    Replica exchangeExploration of conformational spaceIdentification of rare but functionally important states
    Coarse-grained MDLong-timescale dynamics, protein-protein interactionsMembrane organization, potential oligomerization
    QM/MMReaction mechanismDetailed catalytic mechanism, role of specific residues
  • Integration with Experimental Data:

    MD simulations are most powerful when integrated with experimental approaches:

    • Validation of simulation results against biochemical data

    • Use of experimental structures (when available) as starting points

    • Design of experiments to test predictions from simulations

    • Refinement of mechanistic models through iterative simulation and experimentation

By applying these advanced computational approaches, researchers can develop detailed models of PlsY function that extend beyond static structural information, providing a dynamic view of how this essential enzyme operates within the complex environment of the bacterial membrane.

What are the most promising approaches for developing inhibitors targeting Salmonella Newport PlsY?

Developing effective inhibitors against Salmonella Newport PlsY represents a promising avenue for novel antimicrobial strategies. Several approaches show particular potential:

  • Structure-Based Drug Design:

    • Utilize homology models based on related acyltransferases and emerging structural data

    • Identify druggable pockets through computational solvent mapping

    • Employ molecular docking to screen virtual compound libraries

    • Apply fragment-based approaches to build inhibitors targeting the active site

  • Substrate Mimetics:

    • Design non-hydrolyzable analogs of acyl-ACP or acyl-CoA donors

    • Develop glycerol-3-phosphate analogs that compete for binding

    • Create transition state mimics based on the proposed catalytic mechanism

    • Engineer bisubstrate inhibitors that span both substrate binding sites

  • Allosteric Inhibition Strategies:

    • Identify potential allosteric sites through computational analysis and molecular dynamics

    • Screen for compounds that stabilize inactive conformations

    • Target protein-protein or protein-lipid interaction surfaces

    • Develop inhibitors that disrupt essential conformational changes

  • Membrane-Targeted Approaches:

    • Design compounds with appropriate pharmacokinetic properties to access the membrane-embedded active site

    • Develop amphipathic molecules that can partition into the membrane near PlsY

    • Create lipid-conjugated inhibitors that concentrate in bacterial membranes

    • Explore the potential of antimicrobial peptides that may interact with PlsY

  • Screening Methodologies:

    Screening ApproachAdvantagesConsiderations for PlsY
    High-throughput biochemical assaysDirect activity measurementRequires purified protein and appropriate substrates
    Whole-cell phenotypic screensIdentifies compounds with cellular activityMay identify inhibitors of related pathways
    Fragment screening (NMR, X-ray)Identifies weak but efficient bindersChallenging with membrane proteins
    Natural product librariesAccess to diverse chemical spaceExtract complexity and membrane permeability
    Repurposing existing drugsEstablished safety profilesMay require optimization for PlsY specificity
  • Overcoming Potential Resistance Mechanisms:

    • Design inhibitors that bind to highly conserved regions to minimize resistance potential

    • Develop combination approaches targeting multiple steps in phospholipid biosynthesis

    • Create inhibitors with multiple binding modes to reduce resistance probability

    • Engineer molecules too large for efflux pumps or that inhibit both PlsY and efflux systems

  • Translational Considerations:

    • Focus on compounds with selectivity for bacterial over mammalian acyltransferases

    • Prioritize molecules with favorable pharmacokinetic properties

    • Consider formulation strategies to enhance delivery to infection sites

    • Develop assays to assess efficacy in relevant infection models

By pursuing these complementary approaches, researchers can work toward developing effective PlsY inhibitors that may address the growing concern of multidrug-resistant Salmonella Newport infections, potentially providing new therapeutic options for treating infections caused by this pathogen.

How might recombinant PlsY be utilized in developing novel detection methods for Salmonella Newport in food safety applications?

Recombinant Salmonella Newport PlsY can serve as a valuable tool in developing innovative detection methods for food safety applications. These approaches leverage the protein's specificity and biochemical properties to create sensitive and selective detection systems:

  • Antibody-Based Detection Systems:

    • Generate high-affinity monoclonal antibodies against purified recombinant PlsY

    • Develop sandwich ELISA formats for sensitive detection in food samples

    • Create lateral flow immunoassays for rapid field testing

    • Implement immunomagnetic separation techniques for sample enrichment

  • Aptamer-Based Detection:

    • Select DNA or RNA aptamers with high specificity for Salmonella Newport PlsY

    • Develop aptasensors coupling aptamer recognition with electrochemical or optical detection

    • Create aptamer-based capture systems for pre-concentration of bacterial cells

    • Design aptamer beacons that produce fluorescent signals upon PlsY binding

  • Enzymatic Activity-Based Detection:

    • Utilize PlsY's catalytic activity to develop colorimetric or fluorometric assays

    • Engineer synthetic substrates that generate detectable signals upon enzymatic processing

    • Create coupled enzyme assays that amplify detection sensitivity

    • Develop activity-based probes that covalently label active PlsY enzymes

  • Biosensor Platforms:

    Biosensor TypeDetection PrincipleAdvantages for PlsY-Based Detection
    ElectrochemicalMeasures electrical changes upon PlsY binding or activityHigh sensitivity, potential for miniaturization
    Surface plasmon resonanceDetects mass changes during PlsY bindingReal-time, label-free detection
    PiezoelectricMeasures frequency changes upon PlsY bindingHigh sensitivity, potential for array formats
    Field-effect transistorsDetects charge changes upon biomolecular interactionsRapid response, electronic integration
    OpticalMeasures fluorescence, colorimetric, or luminescent signalsVisual readout options, multiplexing potential
  • Phage-Based Detection Systems:

    • Engineer bacteriophages to express reporter genes upon infection of Salmonella Newport

    • Develop phage display systems presenting PlsY-binding peptides or antibody fragments

    • Create phage amplification assays coupled with PlsY-specific detection

    • Implement magnetoelastic biosensors coated with PlsY-binding phage

  • Nucleic Acid-Based Detection Enhanced by PlsY Knowledge:

    • Design PCR primers targeting the plsY gene with serovar-specific variations

    • Develop DNA microarrays incorporating plsY and related genes for strain typing

    • Implement CRISPR-Cas biosensing systems targeting plsY sequences

    • Create isothermal amplification methods for field-deployable detection

  • Integrated and Multiplexed Systems:

    • Combine PlsY detection with other Salmonella biomarkers for improved specificity

    • Develop microfluidic platforms integrating sample preparation and PlsY detection

    • Create array-based systems for simultaneous detection of multiple foodborne pathogens

    • Implement smartphone-based readers for field detection using PlsY-specific assays

  • Food Matrix Considerations:

    • Optimize sample preparation methods to extract Salmonella from complex food matrices

    • Develop approaches to overcome inhibitors present in specific food types

    • Create detection systems that function in high-fat, high-protein, or acidic environments

    • Implement enrichment procedures that maintain PlsY expression and activity

These innovative approaches leveraging recombinant PlsY could significantly enhance food safety by enabling more rapid, sensitive, and specific detection of Salmonella Newport in various food products, potentially preventing outbreaks such as the 2020 red onion contamination incident .

What future research directions could advance our understanding of PlsY's role in bacterial membrane synthesis and pathogenesis?

Future research on Salmonella Newport PlsY promises to deepen our understanding of bacterial membrane biogenesis and pathogenesis. Several key directions could significantly advance the field:

  • Systems Biology Integration:

    • Map the complete interactome of PlsY using proximity labeling approaches

    • Develop comprehensive metabolic models incorporating PlsY regulation

    • Integrate transcriptomic, proteomic, and lipidomic data to understand system-level responses to PlsY modulation

    • Explore the role of PlsY in condition-specific metabolic network rewiring during infection

  • Advanced Structural Biology Approaches:

    • Determine high-resolution structures using emerging technologies for membrane proteins

    • Capture PlsY in different conformational states throughout the catalytic cycle

    • Apply time-resolved structural techniques to visualize substrate binding and product release

    • Implement hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • In Vivo Dynamics and Localization:

    • Develop fluorescent protein fusions or tags that preserve PlsY function

    • Apply super-resolution microscopy to study PlsY localization and dynamics

    • Investigate potential spatial organization of membrane synthesis machinery

    • Examine PlsY distribution during cell division and membrane growth

  • Host-Pathogen Interface Investigations:

    • Study PlsY expression and activity during different stages of infection

    • Investigate how host factors might modulate PlsY function

    • Examine the effect of PlsY-mediated membrane modifications on host immune recognition

    • Explore the connection between membrane composition and bacterial survival in host environments

  • Synthetic Biology Applications:

    Research DirectionApproachPotential Impact
    Engineered membrane compositionControlled expression or modified PlsY variantsDesigner bacterial membranes for biotechnology
    Biosynthetic pathway engineeringIntegration of PlsY with non-native acyl donorsProduction of novel phospholipids
    Minimal cell systemsIncorporation of PlsY into synthetic cellsUnderstanding essential membrane biogenesis requirements
    Biofuel precursor productionPlsY engineering for altered substrate specificityMicrobial production of specialty lipids
  • Environmental Adaptation Mechanisms:

    • Investigate how PlsY activity responds to environmental stressors

    • Examine the role of phospholipid remodeling in adaptation to different hosts

    • Study potential post-translational modifications regulating PlsY under stress

    • Explore connections between membrane fluidity regulation and antimicrobial resistance

  • Comparative Approaches Across Bacterial Species:

    • Conduct systematic comparisons of PlsY function across Salmonella serovars

    • Investigate evolutionary adaptations in PlsY that contribute to host specificity

    • Identify conserved and divergent regulatory mechanisms across species

    • Explore the relationship between PlsY variations and pathogenicity

  • Technological Developments:

    • Develop high-throughput assays for PlsY activity in native-like environments

    • Create biosensors to monitor PlsY activity in real-time during infection

    • Implement CRISPR interference approaches for conditional regulation

    • Design chemical probes to track phospholipid synthesis during the bacterial life cycle

  • Therapeutic Applications Beyond Direct Inhibition:

    • Explore PlsY as a potential vaccine target or diagnostic marker

    • Investigate adjuvant effects of PlsY-derived membrane modifications

    • Develop strategies to potentiate existing antibiotics through PlsY modulation

    • Design delivery systems targeting bacterial membranes based on PlsY insights

  • One Health Perspective Integration:

    • Investigate PlsY's role in Salmonella transmission between food animals and humans

    • Study environmental factors affecting PlsY function in agricultural settings

    • Examine how antibiotic use in agriculture impacts PlsY-related resistance mechanisms

    • Develop PlsY-based interventions applicable across human and veterinary medicine

These multidisciplinary research directions would collectively advance our fundamental understanding of bacterial membrane biogenesis while potentially yielding new strategies for controlling Salmonella Newport infections in both clinical and agricultural contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.