Recombinant Salmonella newport Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; SNSL254_A3679; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
mscL
Target Protein Sequence
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT LREAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFVAIKLINRLNRKKAEEPAAPPAPSKEE VLLGEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the large-conductance mechanosensitive channel (mscL) in Salmonella Newport and how does it differ from other bacterial species?

The large-conductance mechanosensitive channel (mscL) in Salmonella Newport is a membrane protein that functions as a pressure-relief valve during osmotic stress. It forms a homopentameric channel that opens in response to increased membrane tension, allowing rapid efflux of solutes when bacteria experience hypoosmotic shock. While the fundamental structure and function are conserved across bacterial species, Salmonella Newport may possess unique adaptations in its mscL regulation and sensitivity that contribute to its enhanced environmental fitness, particularly in plant colonization where it has been shown to outcompete other Salmonella serovars . Genomic comparative analyses indicate that Salmonella Newport harbors distinct genetic features that differentiate it from other serovars such as Typhimurium, which may extend to its mechanosensitive channel systems .

What genetic approaches have been successful for manipulating genes in Salmonella Newport that could be applied to mscL research?

Lambda red-mediated homologous recombination has proven highly effective for genetic manipulation in Salmonella Newport. This approach allows for precise deletion or modification of target genes, as demonstrated in the development of attenuated vaccine strains . For mscL research, this methodology can be applied using:

  • Design of primers that target regions flanking the mscL gene

  • Introduction of a selectable marker (such as kanamycin resistance)

  • Verification through PCR and sequencing

The following primer design strategy has been effective for Salmonella Newport gene manipulation:

Primer ComponentDesign ConsiderationExample Based on S. Newport aroA Deletion
Forward primer20-25 bp homology to upstream regionaroAmutF (GTCCATCCTCGACTACACCG)
Reverse primer20-25 bp homology to downstream regionaroAmutR (TGCGTTGATATCGCTGGTCA)
Cassette primersInclude antibiotic resistance gene flanking sequencesaroAmutFkan, aroAmutRkan

As demonstrated with the aroA gene deletion in Salmonella Newport, the entire open reading frame can be precisely excised and confirmed genotypically by PCR using primers located at least 500 bp upstream and downstream of the targeted gene .

What are the optimal expression systems for recombinant Salmonella Newport mscL and how should they be optimized?

The expression of membrane proteins like mscL requires specialized approaches. Based on comparative studies with similar bacterial membrane proteins, the following expression systems are recommended for Salmonella Newport mscL:

Expression SystemKey AdvantagesOptimal ConditionsSpecial Considerations
E. coli BL21(DE3)Widely available, high yields0.1-0.2 mM IPTG, 18-20°C, 16-20hMay form inclusion bodies
E. coli C41/C43(DE3)Specifically developed for membrane proteins0.05-0.1 mM IPTG, 18°C, overnightReduces toxic effects
Cell-free systemsAvoids toxicity issues30°C, 12-16h reactionDirect incorporation into liposomes

Key optimization strategies include:

  • Lower induction temperatures (16-20°C) to improve membrane protein folding

  • Addition of glycerol (0.5-1%) to culture media for membrane stabilization

  • Use of specialized membrane-mimicking environments during purification

  • Codon optimization for the expression host

When working with mscL from Salmonella Newport, it is critical to maintain proper membrane protein folding throughout the expression process to preserve channel functionality.

What purification approaches provide the highest yield and functional integrity for Salmonella Newport mscL?

Purification of functional mscL requires careful maintenance of the membrane environment. The recommended multi-step approach includes:

  • Membrane isolation by ultracentrifugation (100,000 × g, 1 hour)

  • Detergent screening and solubilization optimization

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography for final purification

Comparative detergent performance for mscL purification:

DetergentSolubilization EfficiencyFunctional RetentionRecommended Concentration
DDMHigh (80-90%)Moderate (60-70%)1% extraction, 0.05% purification
LMNGModerate-High (70-85%)High (80-90%)1% extraction, 0.01% purification
DigitoninModerate (60-70%)Very High (85-95%)2% extraction, 0.1% purification

Following purification, reconstitution into liposomes or nanodiscs is crucial for functional studies. Similar protein purification principles have been applied effectively in Salmonella Newport vaccine development research, which could inform approaches to mscL purification .

What electrophysiological methods are most appropriate for characterizing Salmonella Newport mscL channel activity?

Patch-clamp electrophysiology remains the gold standard for functional characterization of mechanosensitive channels. For Salmonella Newport mscL, the following electrophysiological approaches are recommended:

  • Spheroplast patch-clamp:

    • Generate giant spheroplasts from E. coli expressing recombinant S. Newport mscL

    • Apply negative pressure to patches in inside-out configuration

    • Record channel openings at various membrane tensions

  • Reconstituted patch-clamp:

    • Incorporate purified mscL into azolectin liposomes

    • Form GΩ seals on liposome blisters

    • Apply defined pressure gradients to quantify:

      • Gating threshold (tension needed for channel opening)

      • Channel conductance (typically 2.5-3.5 nS for bacterial mscL)

      • Open dwell time and kinetics

  • Planar lipid bilayer recordings:

    • Reconstitute purified channels into planar bilayers

    • Apply membrane tension through hydrostatic pressure

    • Record multiple channels simultaneously

These methods allow direct comparison of Salmonella Newport mscL properties with those of other bacterial species, potentially revealing adaptations that contribute to Newport's enhanced environmental fitness.

How can researchers effectively study the structural dynamics of Salmonella Newport mscL during gating?

Understanding the structural transitions during mscL gating requires specialized biophysical approaches:

TechniqueResearch QuestionMethodological ApproachExpected Outcomes
Site-directed spin labeling EPRConformational changes during gatingLabel specific residues with nitroxide spin labelsDistance measurements between residues during channel opening
FRET spectroscopyReal-time monitoring of domain movementsLabel protein with donor/acceptor fluorophoresEnergy transfer efficiency changes during gating
Hydrogen-deuterium exchange MSAccessibility changes during gatingMonitor deuterium incorporation during channel activationIdentification of regions with altered solvent exposure
High-speed AFMVisualize structural transitionsDirect imaging of reconstituted channelsNanoscale visualization of conformational changes
Molecular dynamics simulationsAtomistic modeling of gating mechanismSimulate membrane tension effects on channel structurePrediction of key residues and interactions in gating pathway

These advanced techniques can reveal how Salmonella Newport mscL responds to mechanical stress and potentially identify unique structural features compared to other bacterial mechanosensitive channels.

How might Salmonella Newport mscL contribute to bacterial adaptation to plant environments?

Genomic studies have shown that Salmonella Newport possesses enhanced capabilities for plant colonization compared to other serovars . The mscL channel may play a crucial role in this adaptation through several mechanisms:

  • Osmoregulation during plant colonization:

    • Plant environments expose bacteria to fluctuating osmotic conditions

    • mscL helps manage osmotic transitions in plant tissues

    • Experiments comparing wild-type and mscL-deficient strains in tomato colonization models could elucidate this role

  • Survival under environmental stresses:

    • Salmonella Newport outcompetes other serovars during plant colonization

    • mscL may contribute to survival during desiccation/rehydration cycles

    • Comparative genomics suggests Newport possesses unique adaptations for plant environments

  • Potential interactions with plant defense responses:

    • Plant immune responses can alter osmotic environments

    • mscL may facilitate adaptation to these host-induced stresses

    • Co-expression network analysis could reveal associations between mscL and other plant-adaptation genes

This research direction could help explain why Salmonella Newport has been disproportionately associated with produce-related outbreaks and why it demonstrates superior fitness in plant environments compared to other serovars .

How can Salmonella Newport mscL be exploited for vaccine development purposes?

Building on the successful development of live attenuated Salmonella Newport vaccines described in the research , mscL offers several promising avenues for vaccine engineering:

  • Antigen delivery system:

    • Engineer mscL to display heterologous antigenic peptides

    • The pentameric structure provides multiple display sites

    • mscL gating could be modified to release antigens under specific conditions

  • Attenuated strain development:

    • Creating specific mutations in mscL could generate novel attenuated strains

    • Modified channel function could restrict growth in specific host environments

    • Combine with established attenuation strategies (ΔguaBA, ΔhtrA, ΔaroA)

  • Cross-protection enhancement:

    • Current Salmonella Newport vaccines show limited cross-protection against other serogroups (45% against O:8 serovar S. Muenchen; 28% against O:6,7 serovar S. Virchow)

    • mscL-based vaccines might broaden protection by presenting conserved epitopes

    • Research suggests a multivalent approach combining serovars would be most effective

As noted in recent research: "Our data suggests that separate Salmonella O:6,7 and O:8 vaccines might be needed to confer protection against infections caused by serovars of these serogroups. We anticipate that a multivalent vaccine containing live attenuated vaccines that target serogroups O:4, O:9, O:6,7, and O:8 would be needed to provide protection against the majority of NTS serovars" .

What are common challenges in Salmonella Newport mscL expression and how can they be overcome?

Working with bacterial membrane proteins like mscL presents several challenges:

ChallengePotential CausesSolution StrategiesImplementation Details
Low expression levelsProtein toxicity, poor codon usageUse tight expression control, optimize codonsEmploy pLysS systems, reduce temperature to 16-20°C
Protein aggregationImproper membrane insertion, misfoldingScreen detergents, optimize solubilizationTest panel of detergents (DDM, LMNG, Digitonin)
Loss of functionDetergent-induced denaturation, lipid depletionMaintain native-like environmentAdd specific lipids during purification, use nanodiscs
Inconsistent activityVariable protein quality, lipid compositionStandardize preparation methodsEstablish rigorous quality control for reconstituted samples

Similar challenges were addressed in the development of attenuated Salmonella Newport strains, where genetic manipulation techniques were optimized to ensure consistent expression of modified bacterial proteins .

What experimental controls are essential when working with recombinant Salmonella Newport mscL?

Rigorous controls are necessary to ensure reliable results when working with recombinant mscL:

  • Expression controls:

    • Empty vector control to assess background

    • Well-characterized membrane protein control to validate expression system

    • Western blotting with anti-His and anti-mscL antibodies to confirm expression

  • Functional controls:

    • E. coli MJF455 (mscL deletion strain) complementation assays

    • Pressure response curves of well-characterized mscL homologs

    • Positive control using purified E. coli mscL for electrophysiology experiments

  • Reconstitution controls:

    • Liposome integrity assays (calcein leakage in absence of protein)

    • Protein-free membrane permeability tests

    • Detergent removal verification

  • Data analysis controls:

    • Multiple channel recordings to ensure statistical significance

    • Blind analysis of electrophysiological recordings

    • Randomization of experimental conditions

These controls parallel those used in Salmonella Newport vaccine development, where rigorous testing of attenuated strains ensured both safety and efficacy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.