Recombinant Salmonella newport NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Production and Characterization of Recombinant nuoA

Recombinant nuoA is typically expressed in E. coli systems for research applications. Technical specifications from commercial and academic sources include:

ParameterDetails
Expression SystemE. coli with N-terminal His tag
Purity>90% (SDS-PAGE)
StorageTris/PBS buffer with 50% glycerol; stable at -20°C/-80°C
SequenceFull-length (1-147 aa): MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGR...

3.1. Role in Respiratory Efficiency

  • Salmonella strains lacking ubiquinone (a quinone substrate) exhibit compensatory upregulation of NDH-1, including nuoA, to maintain electron flux via alternative quinones (e.g., menaquinone) .

  • Mutations in adjacent subunits (e.g., nuoG, nuoM, nuoN) alter enzyme activity and quinone affinity, indirectly affecting nuoA’s functional context .

3.2. Enzyme Activity Profiles

Data from S. enterica membrane assays highlight NDH-1 activity dependencies:

StraindNADH-Oxidase ActivitydNADH-DB ActivityQuinone Pool
Wild-type100%100%Ubiquinone, menaquinone
ΔubiA (ubiquinone-deficient)23%45%Demethylmenaquinone
ΔubiA + nuoG(Q297K) suppressor28–66%80–120%Altered composition

Applications in Research

  • Antibiotic Resistance Studies: S. Newport ST45 strains (livestock-associated) exhibit multi-drug resistance (MDR) linked to respiratory adaptations, where NDH-1 activity may influence survival under stress .

  • Diagnostic Tools: Recombinant nuoA is used in ELISA kits for serotype-specific antibody detection .

  • Structural Biology: Supports studies on proton translocation mechanisms and quinone-binding interactions in Complex I .

Challenges and Future Directions

  • Functional Complexity: NDH-1’s multi-subunit architecture complicates isolating nuoA’s individual contributions to proton pumping .

  • Industrial Scaling: Low yield in recombinant expression systems necessitates optimization for large-scale production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; SNSL254_A2512; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNVPFESGIDSVGTA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLARI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase and what role does the nuoA subunit play in Salmonella Newport?

NADH-quinone oxidoreductase (also known as NDH-1 or Complex I) functions as a critical enzyme in the respiratory chain of Salmonella species. The enzyme catalyzes the transfer of electrons from NADH to quinones in the bacterial membrane, contributing to energy production through the generation of proton motive force. The nuoA subunit is one of multiple subunits that form the NDH-1 complex and is specifically located in the membrane domain of the enzyme. In Salmonella Newport, as in other Salmonella species, nuoA contributes to the structure and stability of NDH-1, which is essential for both aerobic and anaerobic respiration .

How does NADH-quinone oxidoreductase function in the electron transport chain of Salmonella Newport?

In Salmonella, ubiquinone serves as the primary mobile electron-carrier during aerobic respiration, while demethylmenaquinone and menaquinone function as alternative electron carriers during anaerobic respiration . The NADH-quinone oxidoreductase (NDH-1) transfers electrons from NADH to these quinones through a complex mechanism involving both hydrophilic and hydrophobic membrane-embedded domains. The hydrophilic domain oxidizes NADH and transfers electrons through a series of iron-sulfur clusters to the hydrophobic domain, which then reduces quinones in the membrane. This electron transfer is coupled to proton translocation across the membrane, contributing to the proton motive force necessary for ATP synthesis and other cellular processes .

What methods are currently available for expressing and purifying recombinant Salmonella Newport nuoA protein?

While specific protocols for S. Newport nuoA expression are not directly detailed in the literature, researchers generally employ a systematic approach that can be adapted for this specific protein. The process typically involves:

  • Gene cloning: The nuoA gene is amplified from S. Newport genomic DNA and cloned into an expression vector containing appropriate promoter elements and affinity tags (typically His-tag).

  • Expression system selection: E. coli BL21(DE3) or similar strains are commonly used, with expression conditions optimized for membrane proteins (lower temperatures, specialized media).

  • Membrane fraction isolation: After cell disruption, the membrane fraction containing the expressed nuoA is separated by ultracentrifugation.

  • Solubilization: Membrane proteins require detergent solubilization (typically using n-dodecyl-β-D-maltoside or similar detergents compatible with protein function).

  • Purification: Affinity chromatography (Ni-NTA for His-tagged constructs) followed by size exclusion chromatography for higher purity.

  • Validation: SDS-PAGE, western blotting, and mass spectrometry to confirm identity and purity.

Researchers must carefully optimize detergent concentrations to maintain protein stability while effectively solubilizing the membrane fraction.

How is Salmonella Newport nuoA genetically and structurally characterized?

Genetic characterization of S. Newport nuoA typically involves DNA sequencing to determine its nucleotide sequence and phylogenetic analysis to compare it with nuoA genes from other Salmonella serotypes. The nuoA gene in Salmonella is part of the nuo operon, which encodes all subunits of the NADH-quinone oxidoreductase complex.

Structural characterization requires more advanced techniques:

  • X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of nuoA, either in isolation or as part of the NDH-1 complex.

  • Circular dichroism spectroscopy to analyze secondary structure composition.

  • Nuclear magnetic resonance (NMR) for analyzing dynamic properties of specific domains.

  • Computational modeling based on homologous proteins when experimental structures are unavailable.

These approaches help determine the transmembrane topology, interaction interfaces with other subunits, and functional domains of the nuoA protein.

What detection methods can identify Salmonella Newport in food and environmental samples?

Detection of Salmonella Newport, including strains expressing nuoA, can be performed using several methodologies. The XP-Design Assay Salmonella Newport is a ready-to-use primer and probe solution specifically designed for the qualitative detection of DNA sequences unique to Salmonella Newport in isolated colonies or in food and environmental samples . This assay utilizes real-time PCR methodology with FAM fluorophore detection.

The standard protocol involves:

  • Sample enrichment following established protocols for food and environmental samples

  • DNA extraction using methods such as the Easy protocol of the iQ-Check Salmonella spp. II method

  • PCR amplification using Salmonella Newport-specific primers

  • Detection and analysis of amplification products

The assay has been tested on various sample types including chicken carcass rinses, turkey sponge swabs, poultry boot swabs, and beef steak, demonstrating the versatility required for comprehensive food safety testing programs .

How do mutations in nuo genes affect respiratory function in Salmonella Newport?

Research on nuo genes in Salmonella has revealed that mutations in these genes can significantly impact respiratory function. While specific nuoA mutations in S. Newport have not been extensively characterized, studies on other nuo genes provide valuable insights. Mutations in nuoG, nuoM, and nuoN have been shown to act as suppressors in strains with defects in ubiquinone biosynthesis, partially rescuing growth and motility .

The nuoG(Q297K), nuoM(A254S), and nuoN(A444E) mutations improved electron flow activity of NADH-quinone oxidoreductase-1 under certain growth conditions, particularly in cells unable to synthesize ubiquinone . These findings suggest that:

  • Mutations in nuo genes, including potentially nuoA, can alter the enzyme's ability to utilize alternative electron carriers like demethylmenaquinone or menaquinone.

  • Such mutations can compensate for deficiencies in the quinone pool by improving the efficiency of electron transfer through NDH-1.

  • The adaptation of respiratory complexes through mutation provides a mechanism for metabolic flexibility in response to changes in electron carrier availability.

These observations indicate that nuoA mutations could similarly affect S. Newport's respiratory capability and metabolic adaptability.

What is the relationship between nuoA function and antimicrobial resistance in Salmonella Newport?

While direct evidence linking nuoA function to antimicrobial resistance in S. Newport is limited, several theoretical connections exist. Multidrug-resistant S. Newport strains, particularly Newport-MDRAmpC isolates, show resistance to multiple antimicrobials including extended-spectrum cephalosporins . These strains have been identified in both human and animal isolates, suggesting transmission through the food chain .

The potential relationships between nuoA and antimicrobial resistance include:

  • Energy-dependent resistance mechanisms: Many resistance mechanisms, including efflux pumps, require energy from the respiratory chain. Changes in nuoA function could affect energy availability for these processes.

  • Metabolic adaptations: Alterations in respiratory function due to nuoA mutations might trigger compensatory metabolic changes that influence susceptibility to certain antibiotics.

  • Growth rate effects: Respiratory efficiency impacts bacterial growth rates, which can alter susceptibility to growth-dependent antibiotics.

Interestingly, case patients with Newport-MDRAmpC infection were more likely to have taken antimicrobial agents to which these strains are resistant during the 28 days before illness onset (OR, 5.0 [95% CI, 1.6-16]) , suggesting that antibiotic use may select for resistant strains.

How does the interaction between nuoA and different quinones affect Salmonella Newport's metabolic flexibility?

Salmonella's ability to utilize different quinones as electron carriers contributes significantly to its metabolic flexibility. Wild-type Salmonella cells produce ubiquinone and menaquinone, while strains with disrupted ubiquinone biosynthesis produce alternative quinones like demethylmenaquinone . This flexibility in quinone utilization allows Salmonella to adapt to various environmental conditions.

The interaction between nuoA and different quinones likely influences:

  • Respiratory efficiency under aerobic vs. anaerobic conditions

  • Energy yield from different carbon sources

  • Ability to colonize different niches within hosts

  • Survival under environmental stress conditions

Experimental evidence shows that NDH-1 can transfer electrons to demethylmenaquinone or menaquinone when ubiquinone is unavailable , demonstrating the respiratory complex's adaptability. The nuoA subunit, as part of the membrane domain of NDH-1, likely contributes to these quinone interactions, though specific mechanisms require further investigation.

What role does nuoA play in the chemotaxis and motility behavior of Salmonella Newport?

While direct evidence for nuoA's role in chemotaxis is limited, research on respiratory function and motility provides valuable insights. Ubiquinone biosynthesis mutants show poor swimming abilities in soft tryptone agar, indicating that proper respiratory function is essential for motility . Suppressor mutations in nuo genes partially rescue this motility defect, suggesting that NADH-quinone oxidoreductase function directly impacts swimming ability.

Recent research has shown that S. Newport exhibits chemotactic attraction to fecal treatments, with even "tighter accumulation of cells at the treatment source compared to S. Typhimurium IR715" . This chemotactic behavior requires energy provided by the respiratory chain, in which nuoA participates as part of NDH-1.

The connections between nuoA and motility likely involve:

  • Energy provision for flagellar rotation through the proton motive force

  • Metabolic sensing that influences chemotactic responses

  • Adaptation to different electron acceptors during chemotaxis through varying environments

These relationships highlight how respiratory components like nuoA contribute to the complex behaviors that facilitate Salmonella's survival and pathogenesis.

How can structural analysis of nuoA contribute to understanding the evolution of Salmonella Newport?

Structural analysis of nuoA can provide significant insights into evolutionary adaptations of Salmonella Newport. By comparing nuoA structures across different Salmonella serotypes and related bacteria, researchers can identify:

  • Conserved domains that indicate essential functional regions maintained through evolutionary pressure

  • Variable regions that might reflect adaptation to specific hosts or environments

  • Structural features that influence interaction with serotype-specific quinone profiles

  • Co-evolutionary patterns with other respiratory components

Such analyses could help explain why certain Salmonella serovars like Newport have emerged as significant human pathogens while maintaining animal reservoirs. The prevalence of Salmonella Newport in both humans and food animals, particularly cattle (93% of cattle isolates in one study were Newport-MDRAmpC) , suggests specific adaptations that facilitate cross-species transmission.

What protocols are recommended for measuring NADH-quinone oxidoreductase activity in Salmonella Newport?

Based on established methodologies, several assays can be employed to measure NADH-quinone oxidoreductase (NDH-1) activity in Salmonella Newport:

Table 1: Comparison of NDH-1 Activity Assay Methods

Assay TypePrincipleComponents MeasuredAdvantagesLimitations
dNADH-oxidaseMeasures NADH oxidation rate with endogenous quinonesComplete NDH-1 electron transfer chainReflects physiological activityDependent on endogenous quinone pool
dNADH-DBUses exogenous ubiquinone analogue (DB)NDH-1 electron transfer independent of quinone poolControls for quinone variationsMay not reflect in vivo conditions
dNADH-K₃Fe(CN)₆ reductaseMeasures NADH dehydrogenase domain activityHydrophilic domain function onlyIsolates specific domain functionDoesn't measure complete electron transfer

The protocols typically involve:

  • Preparation of membrane fractions from bacterial cultures

  • Spectrophotometric measurement of reaction rates under controlled conditions

  • Use of specific inhibitors (e.g., capsaicin-40) to confirm specificity and determine IC₅₀ values

  • Data analysis to determine activity rates and enzyme kinetics

For accurate assessment, researchers should control for protein concentration and use appropriate negative controls such as Δnuo mutant strains .

How can researchers effectively generate and characterize nuoA mutants in Salmonella Newport?

Generation and characterization of nuoA mutants requires a systematic approach:

Mutagenesis Strategies:

  • Targeted mutagenesis:

    • CRISPR-Cas9 system for precise genomic editing

    • Lambda Red recombination for gene replacement

    • Site-directed mutagenesis for specific amino acid changes

  • Random mutagenesis:

    • Error-prone PCR to generate libraries of mutations

    • Chemical mutagens followed by selection for phenotypes of interest

    • Transposon mutagenesis with subsequent identification of nuoA insertions

Characterization Methods:

  • Genetic verification:

    • Whole-genome sequencing to confirm mutations and identify potential secondary mutations

    • PCR amplification and sequencing of the nuoA region

    • Southern blotting to verify genomic integration

  • Functional analysis:

    • Growth curves under aerobic and anaerobic conditions

    • Motility assays in soft agar

    • Respiratory enzyme assays (as detailed in section 3.1)

    • Quinone pool analysis by HPLC

    • Protein expression analysis by immunoblotting

  • Phenotypic assessment:

    • Antimicrobial susceptibility testing

    • Biofilm formation assays

    • Virulence in animal models

    • Competitive fitness assays

This comprehensive approach allows researchers to understand the specific contributions of nuoA to Salmonella Newport physiology and pathogenesis.

What are the most effective methods for studying in vivo expression of nuoA during Salmonella Newport infection?

Studying in vivo expression of nuoA during infection requires techniques that can detect gene expression in the context of host tissues:

  • Transcriptional reporters:

    • Construction of nuoA-reporter fusions (luciferase, GFP)

    • Integration of reporters into the chromosome to maintain native regulation

    • In vivo imaging in animal models to track expression patterns

  • RNA analysis:

    • RNA extraction from infected tissues followed by qRT-PCR

    • RNA-seq to measure nuoA expression relative to the entire transcriptome

    • In situ hybridization to localize nuoA expression within host tissues

  • Protein detection:

    • Generation of specific antibodies against nuoA for immunohistochemistry

    • Tagged versions of nuoA (e.g., His-tag) for detection in recovered bacteria

    • Proteomics analysis of bacteria recovered from infected tissues

  • Single-cell approaches:

    • Laser capture microdissection to isolate bacteria from specific host niches

    • Single-cell RNA-seq to assess nuoA expression in individual bacteria

    • Flow cytometry sorting of bacteria expressing fluorescent reporters

  • Environmental parameter measurement:

    • Correlation of nuoA expression with oxygen levels in different host tissues

    • Analysis of nutrient availability and its impact on nuoA expression

    • pH measurement to correlate with expression patterns

These methods can reveal how nuoA expression changes throughout the infection process and in different host compartments, providing insights into its role in pathogenesis.

How can researchers differentiate between the direct effects of nuoA mutations and compensatory changes in other respiratory components?

Distinguishing primary effects of nuoA mutations from compensatory changes requires a multi-faceted approach:

Table 2: Strategies for Distinguishing Primary and Secondary Effects of nuoA Mutations

ApproachMethodologyOutcome MeasuredAdvantagesLimitations
Complementation analysisIntroduction of wild-type nuoA on plasmidPhenotype restorationDirectly tests nuoA functionPlasmid copy number effects
Temporal gene expressionRNA-seq at different timepoints after mutationSequential adaptationCaptures adaptation dynamicsComplex data interpretation
Targeted proteomicsQuantification of specific respiratory proteinsCompensatory protein changesFocused on relevant pathwaysMay miss unexpected adaptations
Suppressor mutation analysisIdentification of secondary mutationsGenetic compensationIdentifies genetic interactionsLabor intensive
Metabolic flux analysisIsotope labeling and metabolite trackingPathway adaptationsMeasures actual metabolic changesTechnical complexity

Additional approaches include:

  • Controlled mutation introduction:

    • Inducible expression systems to control timing of nuoA mutation

    • Temperature-sensitive alleles for conditional phenotypes

    • Sequential introduction of mutations to track adaptation

  • Comparative omics:

    • Parallel analysis of transcriptome, proteome, and metabolome

    • Integration of datasets to identify coordinated responses

    • Network analysis to identify regulatory nodes

  • Evolutionary approaches:

    • Experimental evolution to track adaptation to nuoA mutations

    • Comparison of independently evolved lines

    • Reversion analysis to identify essential compensatory changes

Through these approaches, researchers can build a comprehensive understanding of how nuoA mutations directly affect bacterial physiology and what compensatory mechanisms emerge to maintain cellular function.

What are the optimal protocols for assessing nuoA-quinone interactions in Salmonella Newport?

Assessment of nuoA-quinone interactions requires specialized techniques addressing both biochemical interactions and functional consequences:

  • Biochemical interaction analysis:

    • Isothermal titration calorimetry to measure binding affinities

    • Surface plasmon resonance for real-time binding kinetics

    • Fluorescence quenching assays with labeled quinones

    • Cross-linking followed by mass spectrometry to identify interaction sites

  • Functional assessments:

    • Enzyme kinetics with different quinone substrates

    • Inhibitor studies using quinone analogues

    • Site-directed mutagenesis of predicted quinone-binding residues

    • Reconstitution of purified components in liposomes

  • Structural approaches:

    • Cryo-EM of NDH-1 with bound quinones

    • Molecular dynamics simulations of quinone binding

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes

    • NMR analysis of specific domains with isotope-labeled quinones

  • In vivo approaches:

    • Growth studies with quinone biosynthesis mutants

    • Complementation with exogenous quinones

    • Competition assays under conditions favoring different quinones

    • Respiration measurements with membrane vesicles

These techniques can reveal how nuoA contributes to quinone specificity and how different quinones influence NDH-1 function in Salmonella Newport.

How can understanding nuoA function contribute to new antimicrobial strategies against Salmonella Newport?

The essential role of respiratory function in bacterial survival makes nuoA a potential target for novel antimicrobial strategies against multidrug-resistant Salmonella Newport:

Table 3: Potential Antimicrobial Strategies Targeting nuoA in Salmonella Newport

StrategyMechanismAdvantagesChallengesCurrent Research Status
Small molecule inhibitorsDirect binding to nuoAHigh specificityMembrane permeabilityEarly-stage research
Quinone analoguesCompetition with natural quinonesLeverages existing transportPotential off-target effectsProof-of-concept studies
Peptide inhibitorsDisruption of protein-protein interactionsHighly specific targetingDelivery into bacterial cellsTheoretical
Combination therapyRespiratory inhibition + conventional antibioticsReduced resistance developmentComplex pharmacodynamicsPreclinical research
Immunological targetingAntibody-mediated during infectionHost immune enhancementLimited accessibilityTheoretical

The fact that Newport-MDRAmpC isolates show resistance to at least nine antimicrobials highlights the urgent need for novel therapeutic approaches. Targeting respiratory components like nuoA represents a strategy distinct from conventional antibiotic targets, potentially overcoming existing resistance mechanisms.

Additionally, nuoA-targeting compounds could be particularly effective against Salmonella Newport in specific environments where the bacterium relies heavily on nuoA function, such as in the anaerobic environment of the intestine or within host cells.

What role could nuoA play in the development of novel detection methods for Salmonella Newport?

The nuoA gene and its protein product offer several opportunities for improving Salmonella Newport detection:

  • Molecular detection:

    • Development of PCR primers targeting nuoA variations specific to S. Newport

    • Integration with existing detection platforms like the XP-Design Assay

    • Multiplex assays targeting nuoA alongside serotype-specific markers

  • Immunological approaches:

    • Production of antibodies against exposed epitopes of nuoA

    • Development of lateral flow assays for rapid detection

    • ELISA-based methods for quantitative analysis

  • Functional detection:

    • Assays measuring NDH-1 activity profiles characteristic of S. Newport

    • Metabolic fingerprinting based on respiratory patterns

    • Growth-based methods in selective media targeting respiratory capabilities

  • Biosensor development:

    • Whole-cell biosensors responding to S. Newport-specific nuoA

    • Aptamer-based detection of nuoA or its functional products

    • Electronic sensors coupled with specific recognition elements

These approaches could enhance the specificity and sensitivity of Salmonella Newport detection, particularly in complex food matrices and environmental samples where current methods face challenges.

How does the NADH-quinone oxidoreductase complex in Salmonella Newport compare with that of other foodborne pathogens?

Comparative analysis of NADH-quinone oxidoreductase across foodborne pathogens reveals important similarities and differences:

Understanding these differences can provide insights into the unique aspects of Salmonella Newport's physiology and pathogenesis, potentially revealing vulnerabilities that can be exploited for control strategies.

What are the implications of nuoA research for understanding Salmonella Newport transmission in the food chain?

Research on nuoA and respiratory function has significant implications for understanding Salmonella Newport transmission through the food chain:

  • Survival in food environments: Respiratory flexibility contributed by nuoA and other NDH-1 components may enhance S. Newport's ability to persist in various food products. This is supported by evidence that Newport-MDRAmpC isolates are found in multiple food animals, including 93% of cattle isolates, 70% of swine isolates, and 30% of chicken isolates in one study .

  • Adaptation to food processing conditions: nuoA function may contribute to S. Newport's ability to adapt to stresses encountered during food processing, such as temperature fluctuations, pH changes, and exposure to sanitizers.

  • Host-to-host transmission: The ability to utilize different electron acceptors through NDH-1 likely contributes to S. Newport's successful transmission between different host species. Case-control studies have found that consumption of uncooked ground beef (OR, 7.8 [95% CI, 1.4-44]) and runny scrambled eggs or omelets (OR, 4.9 [95% CI, 1.3-19]) are risk factors for Newport-MDRAmpC infection .

  • Environmental persistence: Respiratory adaptability may facilitate survival in environmental reservoirs between hosts, contributing to the pathogen's epidemiological success.

These insights could inform risk assessment models and intervention strategies targeting specific points in the food chain where S. Newport's respiratory adaptability plays a crucial role in transmission.

What future research directions would most advance our understanding of nuoA function in Salmonella Newport?

Several key research directions would significantly advance understanding of nuoA in Salmonella Newport:

  • Structural biology:

    • High-resolution structures of nuoA within the complete NDH-1 complex

    • Structural changes associated with different quinone interactions

    • Conformational dynamics during electron transfer

  • Systems biology:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network analysis of respiratory adaptations in different environments

    • Mathematical modeling of respiratory chain function and adaptation

  • Host-pathogen interactions:

    • Role of nuoA in colonization of different host tissues

    • Impact of host-derived factors on nuoA function

    • Contribution to survival within host cells

  • Evolutionary studies:

    • Comparative genomics across Salmonella serotypes

    • Experimental evolution under different selective pressures

    • Tracking of nuoA mutations in clinical and environmental isolates

  • Translational research:

    • Development of nuoA-targeted antimicrobials

    • Exploitation of nuoA function for improved detection methods

    • Vaccine strategies incorporating respiratory antigens

These research directions would not only advance fundamental understanding of Salmonella Newport biology but also contribute to applied aspects of detection, control, and treatment of this important foodborne pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.