Recombinant Salmonella newport NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock
Cat. No.
BT2043988
Source
in vitro E.coli expression system
Synonyms
nuoK; SNSL254_A2503; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Quick Inquiry

Description

Definition and Basic Properties

NADH-quinone oxidoreductase subunit K (nuoK) is a 100-amino-acid transmembrane protein encoded by the nuoK gene in Salmonella newport. Recombinant versions are expressed in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
UniProt IDB4SYZ0
Molecular Weight~11 kDa (calculated)
Expression SystemE. coli
Purity>90% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C; reconstituted in Tris/PBS buffer with 6% trehalose

Functional Role in Respiratory Chain

NuoK is part of Complex I (NADH-quinone oxidoreductase), which:

  1. Transfers electrons from NADH to quinones (e.g., ubiquinone).

  2. Translocates 4 protons across the membrane per 2 electrons transferred .

  3. Supports ATP synthesis via the proton motive force .

Key Research Findings:

  • Electron Transfer Activity: Recombinant nuoK enables electron flow from NADH to demethylmenaquinone or menaquinone in ubiA/ubiE mutant Salmonella strains .

  • Suppressor Mutations: Missense mutations in nuoG (Q297K), nuoM (A254S), or nuoN (A444E) restore motility and respiration in ubiquinone-deficient strains by enhancing NDH-1 activity .

  • Inhibitor Sensitivity: Capsaicin-40 inhibits nuoK-containing complexes with an IC₅₀ of 132–151 nM, similar to wild-type enzymes .

Expression and Purification

  • Host: E. coli .

  • Tags: His tag for affinity chromatography .

  • Yield: 0.1–1.0 mg/mL after reconstitution .

Research Implications

  • Antimicrobial Resistance: While nuoK itself is not linked to resistance, multidrug-resistant Salmonella newport strains (e.g., MDR-AmpC) highlight the need to study respiratory chain adaptations .

  • Biochemical Studies: Recombinant nuoK enables structural-functional analyses of bacterial Complex I, aiding drug discovery against pathogenic Salmonella .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently available in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your own adjustments.
Shelf Life
The shelf life of our products is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. We recommend aliquoting for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
nuoK; SNSL254_A2503; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
nuoK
Target Protein Sequence
MIPLTHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.
B4SYZ0

Target Background

Function
NDH-1 plays a crucial role in electron transport within the respiratory chain. It facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones. In this specific species, ubiquinone is believed to be the primary electron acceptor. This process is coupled with proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved in a proton gradient.
Database Links

KEGG: see:SNSL254_A2503

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.