Recombinant Salmonella newport p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
aaeA; SNSL254_A3628; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
aaeA
Target Protein Sequence
MKTLTRKLSRTAITLVLVILAFIAIFRAWVYYTESPWTRDARFSADVVAIAPDVAGLITH VNVHDNQLVKKDQVLFTIDQPRYQKALAEAEADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYAGEFITRGS TAVALVKKNSFYVQAYMEETKLEGVRPGYRAEITPLGSNRVLKGTVDSVAAGVTNASSTS DAKGMATIDSNLEWVRLAQRVPVRIRLDEQQGNLWPAGTTATVVITGKQDRDASQDSFFR KLAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA efflux pump subunit in Salmonella Newport?

The AaeA protein (previously designated as YhcQ) functions as a membrane fusion protein in the AaeAB efflux pump system. This system is responsible for the export of aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), from the bacterial cell. In Salmonella Newport, as in related Enterobacteriaceae like Escherichia coli, the AaeA subunit works in conjunction with AaeB (the efflux protein) to form a functional transport complex that spans the inner and outer membranes . The AaeA component serves as a critical adapter protein that connects the inner membrane transporter (AaeB) to the outer membrane channel, allowing for efficient efflux of potentially toxic aromatic compounds. Research indicates that this system likely evolved as a "metabolic relief valve" to mitigate the toxic effects of imbalanced metabolism, particularly in environments where aromatic compounds may accumulate .

How does the genetic organization of the aaeA gene region differ between E. coli and Salmonella Newport?

In E. coli, the aaeA gene (formerly yhcQ) is part of an operon that includes aaeX (formerly yhcR) and aaeB (formerly yhcP), with expression regulated by the divergently transcribed aaeR (formerly yhcS) gene, which encodes a LysR-family transcriptional regulator . The genomic organization in Salmonella Newport follows a similar pattern, though with some species-specific variations in the intergenic regions and regulatory elements.

To study these differences, researchers typically employ:

  • Comparative genomic analysis using tools like BLAST and multiple sequence alignment

  • Promoter-reporter fusion assays to detect differences in gene expression regulation

  • DNA footprinting and gel shift assays to identify transcription factor binding sites

The following table summarizes key differences identified through comparative genomics:

FeatureE. coli aaeA regionS. Newport aaeA region
Operon structureaaeXABSimilar to E. coli
RegulatoraaeR (LysR family)Conserved aaeR homolog
Promoter sequence identityReference sequence87-92% identity to E. coli
Inducer responsepHBA, other aromatic acidsSimilar compounds but different sensitivities
Intergenic region length168 bp (aaeR-aaeX)172 bp (aaeR-aaeX)

When conducting comparative studies, it's essential to use matched growth conditions and genetic backgrounds to avoid confounding variables that might affect operon expression and regulation .

What are the recommended methods for cloning and expressing recombinant AaeA from Salmonella Newport?

For recombinant expression of Salmonella Newport AaeA, a systematic approach involving careful optimization of expression conditions is recommended:

  • Gene amplification and vector construction:

    • PCR amplification of the aaeA coding sequence using high-fidelity polymerase

    • Addition of appropriate restriction sites compatible with expression vector

    • Optimal vectors include pET-based systems for E. coli expression or pBAD for regulated arabinose induction

  • Expression host selection:

    • E. coli BL21(DE3) for T7-based expression

    • E. coli with deletions in endogenous aaeA to avoid contamination with host protein

    • Consider Salmonella expression systems for native folding environment

  • Induction and expression optimization:

    • Temperature screening (18°C, 25°C, 30°C, 37°C)

    • Inducer concentration gradient

    • Time-course analysis of expression levels

    • Media composition (LB, TB, minimal media with supplements)

  • Purification strategy:

    • N-terminal or C-terminal affinity tags (His6, FLAG, MBP)

    • Membrane protein extraction using mild detergents (DDM, LDAO)

    • Size-exclusion chromatography for final polishing

When expressing membrane fusion proteins like AaeA, it's critical to maintain the native structure. Researchers often employ techniques similar to those used for the E. coli homolog, including solubilization with appropriate detergents and careful optimization of buffer conditions to maintain stability during purification .

How can one design mutagenesis studies to identify critical functional domains in Salmonella Newport AaeA?

Designing effective mutagenesis studies for Salmonella Newport AaeA requires a multi-faceted approach:

  • Structure-guided mutagenesis:

    • Begin with in silico structural prediction using tools like AlphaFold2 or homology modeling based on the E. coli homolog

    • Identify conserved domains through multiple sequence alignment with other membrane fusion proteins

    • Target residues at predicted interfaces with AaeB or outer membrane components

  • Systematic scanning mutagenesis:

    • Alanine scanning of charged or conserved residues

    • Domain swapping with homologs to identify functional regions

    • Cysteine scanning for accessibility studies and crosslinking experiments

  • Functional validation methods:

    • Complementation assays in aaeA deletion strains

    • pHBA tolerance assays to assess efflux function (using methods similar to those in E. coli studies)

    • Protein-protein interaction assays (bacterial two-hybrid, co-immunoprecipitation)

  • Readout optimization:

    • Develop rapid screening methods using fluorescent pHBA analogs

    • Implement growth-based selection strategies in high pHBA concentrations

    • Consider reporter gene fusions to monitor protein folding and stability

When conducting mutagenesis studies, it's crucial to consider the membrane-associated nature of AaeA. Mutations may affect not only substrate specificity but also proper membrane localization and interaction with partner proteins. Additionally, employing techniques like lambda red-mediated recombination (similar to methods used for S. Newport vaccine strain construction) can facilitate chromosomal integration of mutant alleles for physiologically relevant studies .

What approaches are most effective for studying the interaction between AaeA and AaeB in the context of p-hydroxybenzoic acid efflux?

Investigating the AaeA-AaeB interaction in Salmonella Newport requires specialized techniques for membrane protein complexes:

  • In vivo interaction studies:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Split fluorescent protein complementation assays

    • Co-immunoprecipitation using differentially tagged proteins

    • Genetic suppressor analysis to identify compensatory mutations

  • In vitro reconstitution:

    • Co-purification of the AaeA-AaeB complex using tandem affinity tags

    • Liposome reconstitution assays to measure transport activity

    • Native mass spectrometry of membrane protein complexes

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Structural biology approaches:

    • Cryo-electron microscopy of purified complexes

    • X-ray crystallography of stabilized complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Functional coupling analysis:

    • Transport assays using purified components in proteoliposomes

    • Electrophysiology studies in planar lipid bilayers

    • Fluorescence-based transport assays with quenched fluorescent substrates

When designing these experiments, it's important to consider that AaeA-AaeB interactions may be transient or dependent on substrate binding. Techniques that can capture dynamic interactions, such as time-resolved FRET or single-molecule approaches, may provide insights not accessible through static methods. Additionally, comparison with the better-characterized E. coli system can guide experimental design and interpretation .

How does the substrate specificity of Salmonella Newport AaeA-AaeB differ from that of E. coli, and what methods best elucidate these differences?

Investigating substrate specificity differences between Salmonella Newport and E. coli AaeA-AaeB efflux systems requires systematic comparative approaches:

  • Comparative growth inhibition assays:

    • Minimum inhibitory concentration (MIC) determination for various aromatic carboxylic acids

    • Growth curve analysis in the presence of substrate candidates

    • Cross-complementation studies with heterologous expression

  • Direct transport measurements:

    • Radiolabeled substrate accumulation/efflux assays

    • Fluorescent substrate analogs with real-time monitoring

    • LC-MS/MS detection of intracellular vs. extracellular substrate concentrations

  • Binding affinity studies:

    • Isothermal titration calorimetry with purified components

    • Surface plasmon resonance with immobilized proteins

    • Fluorescence-based binding assays with substrate analogs

  • In silico approaches:

    • Molecular docking of potential substrates

    • Molecular dynamics simulations of substrate passage

    • Quantitative structure-activity relationship (QSAR) modeling

The E. coli AaeA-AaeB system has shown specificity for a narrow range of aromatic carboxylic acids, with pHBA as a primary substrate . Research suggests that only a few aromatic carboxylic acids of hundreds tested were defined as substrates for the E. coli system. For Salmonella Newport, similar specificity profiling would be expected, though potentially with adaptations reflecting its different ecological niche and exposure to host defense compounds.

When conducting comparative studies, it's crucial to use isogenic strains with matched genetic backgrounds and consistent expression levels to ensure that observed differences truly reflect protein function rather than expression artifacts or genetic context effects .

How can understanding AaeA function in Salmonella Newport contribute to vaccine development strategies?

Understanding AaeA function in Salmonella Newport can significantly impact vaccine development through several mechanisms:

  • Attenuation strategies:

    • Deletion or modification of aaeA can potentially serve as an attenuation strategy for live vaccine strains

    • Disruption of efflux systems may increase bacterial sensitivity to host antimicrobial compounds

    • Combined with other attenuating mutations (like those in guaBA, htrA, and aroA used in CVD 1979), aaeA modifications could fine-tune attenuation levels

  • Antigen expression platforms:

    • The regulatory elements of the aaeA operon could be harnessed for controlled antigen expression

    • Induction by specific aromatic compounds could enable environmentally responsive vaccine strains

    • Expression timing could be optimized for maximum immunogenicity

  • Cross-protection considerations:

    • Antibodies against AaeA would likely show serogroup specificity similar to those against O-polysaccharide

    • Vaccines targeting conserved regions of AaeA might provide broader protection than LPS-based approaches

    • Combination strategies targeting both O-antigens and conserved proteins may enhance efficacy

  • Adjuvant effects:

    • Modification of efflux systems may alter bacterial interaction with host cells

    • Changes in membrane composition resulting from efflux disruption could enhance immunogenicity

    • Controlled accumulation of specific compounds might modulate immune responses

Current S. Newport vaccine strategies, such as CVD 1979, focus on deletions in metabolic and stress-response genes (guaBA, htrA, and aroA) . These have shown efficacy against homologous challenge but limited cross-protection against heterologous serovars. Adding efflux pump modifications could potentially enhance vaccine safety profiles while maintaining immunogenicity.

Research on opsonophagocytic antibody (OPA) activity suggests that serogroup-specific protection is primarily mediated by antibodies against O-polysaccharides . Complementary approaches targeting conserved systems like AaeA-AaeB could potentially broaden protection across serogroups.

What role might the AaeA-AaeB efflux system play in Salmonella Newport antimicrobial resistance, particularly in outbreak strains?

The AaeA-AaeB efflux system's potential contribution to antimicrobial resistance in outbreak strains of Salmonella Newport warrants detailed investigation:

The 2018-2019 outbreak of multidrug-resistant S. Newport with decreased susceptibility to azithromycin affected 255 individuals and caused 60 hospitalizations in the United States . While specific efflux mechanisms were not detailed in the outbreak report, the presence of resistance genes on plasmids was noted as concerning due to potential for horizontal transfer. Investigating the possible contribution of chromosomally encoded systems like AaeA-AaeB alongside plasmid-mediated resistance would provide a more comprehensive understanding of resistance development.

What experimental approaches can distinguish between the functional roles of AaeA in detoxification versus metabolic regulation in Salmonella Newport?

Distinguishing between detoxification and metabolic regulatory roles of AaeA requires sophisticated experimental designs:

  • Metabolomics approaches:

    • Untargeted metabolomics comparing wild-type and aaeA mutant strains

    • Flux analysis using 13C-labeled substrates to track metabolic pathways

    • Targeted analysis of aromatic acid intermediates under different growth conditions

    • Temporal metabolomic profiling during growth phase transitions

  • Transcriptional response analysis:

    • RNA-seq comparing wild-type and aaeA mutant responses to metabolic perturbations

    • ChIP-seq for AaeR binding under different metabolic conditions

    • Promoter-reporter fusions to monitor real-time expression dynamics

    • Single-cell transcriptional analysis to detect heterogeneity in metabolic responses

  • Physiological assays:

    • Growth phenotype microarrays under diverse metabolic conditions

    • Competition assays between wild-type and mutant strains under metabolic stress

    • Survival under fluctuating nutrient availability mimicking host environments

    • Bacterial cytological profiling to detect subcellular changes

  • Protein interaction studies:

    • Affinity purification-mass spectrometry to identify interaction partners beyond AaeB

    • Screening for genetic interactions using transposon insertion sequencing (Tn-seq)

    • Synthetic genetic array analysis to map genetic interaction networks

    • Protein localization studies under different metabolic states

The hypothesis that AaeA-AaeB functions as a "metabolic relief valve" suggests a role beyond simple xenobiotic detoxification. This system may help maintain homeostasis during imbalanced metabolism, particularly when aromatic compounds accumulate due to pathway disruptions. In Salmonella Newport, which encounters varied environments during infection (intestinal lumen, intracellular niche, etc.), this function may be particularly important for adaptation.

Experiments should be designed to differentiate between exogenous toxin efflux and endogenous metabolite management. For example, comparing the accumulation of radiolabeled exogenous pHBA versus endogenously produced aromatic intermediates could help distinguish these roles. Similarly, examining aaeA expression during different metabolic states (glycolysis vs. gluconeogenesis, aerobic vs. anaerobic) may reveal patterns consistent with metabolic regulation rather than simple detoxification.

What are the optimal conditions for measuring AaeA-mediated efflux activity in Salmonella Newport?

Establishing robust assays for AaeA-mediated efflux activity requires careful optimization:

  • Cell-based efflux assays:

    • Preparation of cells:

      • Growth phase standardization (mid-log typically optimal)

      • Media composition (minimal media preferred to reduce background)

      • Energy depletion/repletion protocol optimization

    • Substrate selection:

      • Radiolabeled pHBA (most direct measurement)

      • Fluorescent pHBA derivatives (allow real-time monitoring)

      • Substrate concentration optimization (typically 10-100 μM)

    • Measurement parameters:

      • Time course (rapid sampling: 15s, 30s, 1min, 2min, 5min)

      • Temperature control (25°C vs. 37°C)

      • Buffer composition (pH, ionic strength, carbon source)

  • Membrane vesicle-based assays:

    • Vesicle preparation:

      • Inside-out vs. right-side-out vesicles

      • Membrane protein content standardization

      • Vesicle size and homogeneity verification

    • Energization methods:

      • NADH for respiratory chain coupling

      • ATP for direct energization

      • Ion gradients for secondary transport

    • Detection methods:

      • Filtration-based separation of vesicles from media

      • Continuous fluorescence monitoring

      • LC-MS/MS quantification of substrate concentrations

  • Reconstituted proteoliposome assays:

    • Protein reconstitution:

      • Lipid composition optimization (E. coli extract vs. defined mixtures)

      • Protein:lipid ratio optimization (typically 1:50 to 1:200)

      • Co-reconstitution of AaeA with AaeB

    • Assay conditions:

      • Artificial gradients (pH, electrical, substrate)

      • Temperature and buffer optimization

      • Counterflow methodologies for enhanced sensitivity

  • Controls and validations:

    • Isogenic strains lacking aaeA or aaeB

    • Competitive inhibition with unlabeled substrates

    • Metabolic inhibitors (CCCP, arsenate) to confirm energy-dependence

    • Positive controls using well-characterized efflux systems

The most reliable results typically come from combining multiple methodologies. For instance, whole-cell assays provide physiologically relevant data but can be affected by multiple cellular factors, while reconstituted systems offer mechanistic clarity but may lack physiological context. The choice between these approaches should be guided by the specific research question being addressed.

How can researchers effectively differentiate between AaeA function and other efflux systems in Salmonella Newport?

Distinguishing AaeA-specific functions from those of other efflux systems requires strategic experimental design:

  • Genetic approaches:

    • Generation of precise knockout mutants (ΔaaeA, ΔaaeB, ΔaaeAB)

    • Construction of multiple efflux system knockouts (e.g., ΔaaeAB ΔacrAB)

    • Complementation with wild-type and mutant alleles under controlled expression

    • Inducible expression systems for titrated protein levels

    • CRISPR interference for tunable gene repression

  • Biochemical discrimination:

    • Substrate specificity profiling against known substrates of other efflux systems

    • Inhibitor studies using system-specific inhibitors where available

    • Energetic requirements (primary vs. secondary active transport)

    • pH dependency profiles that may differ between systems

  • Structural biology approaches:

    • System-specific antibodies for immunolocalization

    • Fluorescent protein fusions to track localization patterns

    • Proximity labeling to identify specific interaction partners

    • Cross-linking mass spectrometry to map structural relationships

  • Computational methods:

    • Sequence-based classification of efflux systems

    • Structural modeling to predict substrate binding sites

    • Machine learning approaches to differentiate substrate profiles

    • Systems biology modeling of efflux network interactions

The following table outlines key differences that can help distinguish major efflux systems in Salmonella:

PropertyAaeA-AaeBAcrAB-TolCEmrABMdtABC
Primary substratesAromatic carboxylic acidsAntibiotics, dyes, detergentsHydrophobic compoundsBile salts
Energy sourcePMFPMFPMFPMF
Components2 (AaeA, AaeB)3 (AcrA, AcrB, TolC)2 (EmrA, EmrB)3 (MdtA, MdtB, MdtC)
RegulationAaeR (inducer: pHBA)AcrR, MarA, SoxSEmrRBaeSR
Sensitivity to CCCPHighHighHighHigh
Sensitivity to PAβNLowHighModerateModerate

When conducting these experiments, it's critical to maintain consistent experimental conditions across comparisons and to include appropriate controls for each system being studied. This approach enables confident attribution of phenotypes to specific efflux systems rather than general membrane perturbations or secondary effects.

What are the challenges and solutions in structural studies of the AaeA membrane fusion protein from Salmonella Newport?

Structural characterization of membrane fusion proteins like AaeA presents specific challenges requiring specialized approaches:

  • Challenges in protein production:

    • Membrane-associated nature complicates expression and purification

    • Potential toxicity when overexpressed

    • Conformational heterogeneity depending on interaction state

    • Requirement for detergents or membrane mimetics

    Solutions:

    • Fusion tags to enhance solubility (MBP, SUMO)

    • Controlled expression systems (tight regulation, low temperature)

    • Screening multiple constructs with variable N/C-terminal boundaries

    • Coexpression with stabilizing partners

    • Expression in specialized strains (e.g., C41/C43 for membrane proteins)

  • Challenges in protein purification:

    • Detergent selection critical for stability and activity

    • Tendency for aggregation during concentration

    • Potential for unfolding during purification steps

    • Heterogeneity in oligomeric state

    Solutions:

    • Systematic detergent screening (DDM, LMNG, LDAO)

    • Addition of lipids during purification to maintain native environment

    • Size-exclusion chromatography as final polishing step

    • On-column detergent exchange methods

    • Thermostability assays to monitor protein quality

  • Challenges in structural determination:

    • Flexibility in linking domains

    • Multiple conformational states depending on substrate/partner binding

    • Difficulties in crystallization of membrane-associated proteins

    • Resolution limitations in regions contacting membranes

    Solutions:

    • Cryo-electron microscopy for visualization of different conformational states

    • X-ray crystallography with stabilizing antibody fragments

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Integrative structural biology combining multiple techniques

    • Molecular dynamics simulations to model membrane interactions

  • Challenges in functional correlation:

    • Connecting structural features to transport mechanism

    • Identifying domains involved in substrate specificity vs. protein interactions

    • Determining state-dependent conformational changes

    Solutions:

    • Site-directed spin labeling for distance measurements

    • Disulfide crosslinking to trap functional states

    • Targeted mutagenesis of predicted functional residues

    • Chimeric proteins to map domain-specific functions

Recent advances in structural biology methods, particularly cryo-EM, have revolutionized the study of membrane protein complexes. For AaeA, approaches similar to those used for related membrane fusion proteins like AcrA could be applied. The judicious use of nanodiscs or amphipols as alternatives to detergents has also proven valuable for maintaining native-like environments during structural studies of membrane-associated proteins.

How does the evolution of the AaeA-AaeB system in Salmonella Newport compare to other enteric pathogens, and what methods best elucidate evolutionary relationships?

Investigating the evolutionary history of the AaeA-AaeB system requires comprehensive comparative genomics and phylogenetic approaches:

  • Phylogenomic analysis:

    • Identification of orthologs across diverse bacterial species

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Reconciliation of gene trees with species trees to identify horizontal gene transfer events

    • Synteny analysis to examine conservation of genomic context

  • Sequence-based evolutionary analysis:

    • Calculation of selection pressures (dN/dS ratios) across different lineages

    • Identification of positively selected sites using methods like PAML or HyPhy

    • Coevolution analysis between AaeA and AaeB to detect coordinated changes

    • Ancestral sequence reconstruction to infer evolutionary trajectories

  • Structural evolution analysis:

    • Homology modeling of AaeA across different species

    • Mapping of conserved vs. variable regions onto structural models

    • Prediction of functional consequences of evolutionary changes

    • Analysis of coevolving residue networks within protein structures

  • Functional divergence testing:

    • Heterologous expression of AaeA-AaeB from different species

    • Substrate specificity comparison across evolutionary lineages

    • Complementation assays to test functional interchangeability

    • Engineering of chimeric proteins to map species-specific functional regions

Preliminary analyses suggest that the AaeA-AaeB system is widely distributed among Enterobacteriaceae but shows varying patterns of conservation. The system appears to have undergone functional specialization in different lineages, potentially reflecting adaptation to specific ecological niches. In Salmonella serovars, the system may have evolved in response to specific host environments and defense mechanisms.

When conducting evolutionary analyses, it's important to account for the potential confounding effects of recombination and horizontal gene transfer, which are common in bacterial genomes. Methods like ClonalFrameML or Gubbins can help identify and account for recombination events when constructing phylogenies.

How do transcriptional regulation patterns of aaeA differ between Salmonella Newport and E. coli, and what experimental designs best capture these differences?

Comparing transcriptional regulation of aaeA between species requires carefully designed comparative experiments:

  • Promoter architecture analysis:

    • Detailed mapping of promoter elements using 5' RACE and primer extension

    • Identification of transcription factor binding sites using DNase footprinting

    • Mutational analysis of predicted regulatory elements

    • Comparative reporter assays with promoters from different species

  • Transcription factor characterization:

    • Purification and characterization of AaeR from both species

    • DNA binding assays (EMSA, fluorescence anisotropy) with cognate promoters

    • Determination of inducer binding properties and affinities

    • Protein-protein interaction analysis to identify cofactors

  • Global regulatory network mapping:

    • ChIP-seq analysis to identify genome-wide binding patterns of AaeR

    • RNA-seq under inducing and non-inducing conditions

    • Network analysis to identify regulatory connections with other systems

    • Integration with stress response and metabolic networks

  • Single-cell analysis approaches:

    • Single-cell RNA-seq to detect population heterogeneity in expression

    • Time-lapse microscopy with fluorescent reporters

    • Microfluidics-based analysis of expression dynamics

    • Noise analysis to characterize stochastic aspects of regulation

The E. coli AaeA system is known to be regulated by AaeR, a LysR-family transcriptional regulator that responds to aromatic carboxylic acids, particularly pHBA . While the general regulatory architecture is likely conserved in Salmonella Newport, species-specific differences may exist in the fine-tuning of regulation, including:

  • Differences in operator sequences affecting binding affinity

  • Variations in inducer specificity and sensitivity

  • Integration with species-specific global regulators

  • Responses to environmental conditions relevant to each species' ecological niche

When designing comparative transcriptional studies, it's crucial to maintain equivalent genetic backgrounds and experimental conditions. Ideally, experiments should include reciprocal analysis where regulatory elements from each species are tested in both homologous and heterologous contexts to distinguish intrinsic properties from contextual effects.

What emerging technologies hold the most promise for advancing our understanding of AaeA function in Salmonella Newport?

Several cutting-edge technologies offer significant potential for deepening our understanding of AaeA function:

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) for visualizing membrane protein organization

    • Single-molecule tracking to monitor dynamics and interactions in live cells

    • Correlative light and electron microscopy for contextual structural information

    • Expansion microscopy for enhanced spatial resolution of protein complexes

  • Systems-level approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Genome-wide CRISPR screening to identify genetic interactions

    • Global protein interaction mapping through proximity labeling

    • Machine learning for prediction of functional relationships

  • Structural biology innovations:

    • Time-resolved cryo-EM for capturing transient conformational states

    • Microcrystal electron diffraction for membrane proteins resistant to traditional crystallization

    • Integrative modeling combining low and high-resolution structural data

    • Advanced computational prediction methods like AlphaFold for protein complexes

  • Functional characterization tools:

    • Optogenetic control of protein activity in live cells

    • Microfluidics for precise manipulation of chemical environments

    • Biosensors for real-time monitoring of efflux activity

    • In vivo chemical biology approaches for targeted protein manipulation

Particularly promising are technologies that bridge structural insights with functional understanding, such as:

  • Time-resolved studies that capture the dynamic nature of transport processes

  • Single-molecule approaches that reveal heterogeneity masked in bulk measurements

  • In situ structural methods that preserve native contexts

  • Systems approaches that place AaeA function within broader cellular networks

For Salmonella Newport specifically, technologies that enable study in infection-relevant contexts would be especially valuable, such as those allowing visualization or measurement of AaeA function during host-pathogen interactions or within infection models that recapitulate relevant physiological environments.

What aspects of AaeA function remain poorly understood, and what experimental approaches might address these knowledge gaps?

Despite advances in understanding AaeA function, several critical knowledge gaps remain:

  • Structural transitions during transport cycle:

    • Knowledge gap: The conformational changes that AaeA undergoes during the transport cycle remain largely uncharacterized.

    • Experimental approaches:

      • Single-molecule FRET to measure distance changes during transport

      • Disulfide crosslinking to trap intermediate states

      • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

      • Time-resolved cryo-EM with substrate analogs or transition state mimics

  • Substrate recognition mechanisms:

    • Knowledge gap: The molecular basis for substrate specificity and recognition is not well defined.

    • Experimental approaches:

      • Co-crystallization with substrate analogs

      • Systematic mutagenesis of predicted binding pocket residues

      • Computational docking combined with experimental validation

      • Development of high-throughput substrate screening methods

  • Regulatory network integration:

    • Knowledge gap: How AaeA expression and function integrate with broader cellular processes remains unclear.

    • Experimental approaches:

      • Multi-stress transcriptomics to map condition-dependent regulation

      • Protein-protein interaction screening to identify regulatory partners

      • Metabolic flux analysis under conditions of altered AaeA activity

      • Network modeling to predict system-level effects of AaeA perturbation

  • Host-pathogen interaction relevance:

    • Knowledge gap: The role of AaeA during Salmonella Newport infection is poorly characterized.

    • Experimental approaches:

      • In vivo expression analysis during different infection stages

      • Competitive index experiments with aaeA mutants in animal models

      • Identification of host-derived substrates or inhibitors

      • Tissue-specific visualization of AaeA activity during infection

How might synthetic biology approaches be applied to engineer novel functions in the AaeA-AaeB system of Salmonella Newport?

Synthetic biology offers powerful approaches for engineering the AaeA-AaeB system for novel functions:

  • Substrate specificity engineering:

    • Approach: Directed evolution of AaeA-AaeB for altered substrate profiles

    • Methods:

      • Error-prone PCR combined with selection for growth on novel substrates

      • PACE (Phage-Assisted Continuous Evolution) for rapid protein evolution

      • Semi-rational design targeting predicted substrate binding residues

      • Domain swapping with related transporters having different specificities

  • Biosensor development:

    • Approach: Engineering AaeA-AaeB-based detection systems

    • Methods:

      • Coupling substrate transport to reporter gene expression

      • Creating FRET-based sensors using conformational changes

      • Developing whole-cell biosensors for environmental monitoring

      • Engineering allosteric regulation to create tunable response elements

  • Therapeutic applications:

    • Approach: Engineering Salmonella delivery systems

    • Methods:

      • Modifying AaeA-AaeB to export therapeutic compounds

      • Creating conditional expression systems for targeted drug delivery

      • Engineering substrate-responsive killing mechanisms

      • Developing vaccine strains with optimized antigen presentation

  • Metabolic engineering applications:

    • Approach: Enhancing production of valuable compounds

    • Methods:

      • Engineering efflux capacity to reduce product toxicity

      • Creating orthogonal transport systems for pathway compartmentalization

      • Coupling product export to biosynthetic pathways

      • Developing feedback-resistant variants for enhanced production

A particularly promising direction is the engineering of Salmonella Newport strains for therapeutic applications. Building on the established use of attenuated Salmonella as vaccine vectors , engineered AaeA-AaeB systems could enhance vaccine efficacy by controlling antigen presentation or improving bacterial survival in specific host environments.

For successful application of these approaches, robust characterization methods and predictive models will be essential. This includes development of high-throughput screening methods for transporter function, computational tools for predicting the effects of mutations, and systems-level models that can anticipate the consequences of engineering interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.