Recombinant Salmonella newport Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; SNSL254_A4896; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
mdoB
Target Protein Sequence
MSELLSVALFLASVLIYAWKAGRNTWWFAATLTVLGLFVILNITLYASDYFTGDGINDAV LYTLTNSLTGAGVGKYILPGIGIALALVAVFGALGWILRRRRHHPHHVGYSLLALLLALG SVDASPAFRQITELVKSQMRDGDPDFAVYYKEPAKTIPNPKLNLVYIYGESLERTYFDND AFPNLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEALSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDYDGKPNQS FSAVSCSQENIAEFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFILRG DKPQQETLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNVKEKVLAMKPD IIRLWNFPKEIKAFTIDRDKNTIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWIDRCYKMAQLWAPALALSTDWCVSQGQLGGQQTVQHVDKAQWQGKTAFKD TMIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKAPLPKKFDLVITAKAFGDNANRPIPVRVGNEEQTLVLGHDVSTITLHFNNP TDANTLVIAPPAPVSTNEGNILGHSPRKLGIGMVEIKVVNVEG
Uniprot No.

Target Background

Function
Phosphoglycerol transferase I (mdoB) from *Salmonella newport* catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (mdoB) and what is its primary function?

Phosphoglycerol transferase I (mdoB) is an enzyme located in the inner cytoplasmic membrane of gram-negative bacteria including Salmonella newport. It functions as a phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase (EC 2.7.8.20), catalyzing the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) . This enzymatic activity is crucial for bacterial membrane composition and integrity, as it modifies the MDO structure by adding phosphoglycerol moieties . Experimental evidence from knockout studies demonstrates that mdoB mutants produce MDOs completely devoid of phosphoglycerol residues, confirming its essential role in MDO glycerophosphorylation in vivo .

What are the alternative gene names and identifiers for Phosphoglycerol transferase I in Salmonella newport?

Phosphoglycerol transferase I in Salmonella newport is encoded by genes with multiple identifiers in genomic databases. The primary gene names include:

Primary NameAlternative Gene NamesSpecific Identifiers
mdoBopgBSNSL254_A4896

These alternative designations reflect the evolution of nomenclature and cross-species homology identification in bacterial genomics . When citing this gene in research publications, it is recommended to include both the primary and alternative designations to ensure clarity across different database references.

What expression systems are most effective for producing recombinant Salmonella newport Phosphoglycerol transferase I?

Multiple expression systems have been validated for the recombinant production of Salmonella newport Phosphoglycerol transferase I, each with distinct advantages:

Expression SystemAdvantagesPurity Level Achieved
E. coliHigh yield, cost-effective, rapid production≥85% by SDS-PAGE
YeastPost-translational modifications, secretion capability≥85% by SDS-PAGE
BaculovirusComplex folding, higher eukaryotic modifications≥85% by SDS-PAGE
Mammalian CellNative-like modifications, complex structure support≥85% by SDS-PAGE
Cell-Free ExpressionRapid production, avoids toxicity issues≥85% by SDS-PAGE

The selection of an appropriate expression system depends on the specific research requirements, including needed protein yield, post-translational modifications, and downstream applications . For structural studies requiring highly pure protein, additional purification steps beyond the standard protocols may be necessary.

What is the precise enzymatic reaction catalyzed by Phosphoglycerol transferase I?

Phosphoglycerol transferase I catalyzes a specific glycerophosphoryl transfer reaction where phosphoglycerol moieties are transferred from phosphatidylglycerol (a membrane phospholipid) to membrane-derived oligosaccharides (MDOs) . The reaction can be represented as:

Phosphatidylglycerol + MDO → Diacylglycerol + MDO-phosphoglycerol

This reaction contributes to the negative charge of periplasmic MDOs and affects membrane properties. The enzyme has been shown to function in the inner cytoplasmic membrane, with the catalytic site likely oriented toward the cytoplasmic face . The reaction requires specific recognition of both the donor phospholipid and the acceptor oligosaccharide, suggesting a precise structural mechanism for substrate recognition.

How can researchers assay Phosphoglycerol transferase I activity in vitro?

Standard protocols for assaying Phosphoglycerol transferase I activity involve:

  • Preparation of membrane fractions containing the enzyme by sonication of bacterial cells in buffer containing 2-mercaptoethanol

  • Incubation of the membrane preparation with appropriate substrates (phosphatidylglycerol and MDOs)

  • Measurement of phosphoglycerol transfer using either:

    • Radioactive assays with labeled phosphatidylglycerol

    • Colorimetric determination of released glycerol after HF treatment

    • Quantification of phosphoglycerol residues on MDOs

A typical assay can detect activity levels of approximately 6.0 nmol/h per mg of protein in wild-type strains, while mdoB mutants show activity below the detection limit (<0.05-0.09 nmol/h per mg) . For accurate results, researchers should include appropriate controls and ensure the integrity of membrane preparations throughout the procedure.

What effect do mdoB mutations have on membrane-derived oligosaccharide composition?

Mutations in the mdoB gene have profound and specific effects on MDO composition:

StrainPhosphoglycerol transferase I activity (nmol/h per mg of protein)mol of Phosphoglycerol per mol of MDO
Wild-type (AB1133 mdoB+)6.02.0
NFB114 mdoB1<0.050.06
PT227 mdoB::TnJO<0.090.05

What experimental approaches are most effective for studying the in vivo function of Phosphoglycerol transferase I?

Several complementary approaches have proven effective for investigating the in vivo function of Phosphoglycerol transferase I:

  • Genetic approaches:

    • Creation of precise mdoB knockouts using transposon mutagenesis (e.g., mdoB::TnJO)

    • Identification of spontaneous mdoB mutants through selection on arbutin-containing media

    • Three-factor crosses via P1 transduction to map the gene location and confirm genetic linkage

  • Biochemical approaches:

    • Isolation and structural characterization of MDOs from wild-type and mutant strains

    • Quantitative analysis of phosphoglycerol content in MDOs using HF treatment to liberate glycerol

    • Membrane preparation and in vitro reconstitution of enzyme activity

  • Physiological approaches:

    • Assessment of membrane integrity in mdoB mutants under various growth conditions

    • Evaluation of response to osmotic stress and other environmental challenges

    • Analysis of antibiotic sensitivity profiles, particularly relevant given the emergence of multidrug-resistant strains of Salmonella Newport

These combined approaches provide a comprehensive understanding of Phosphoglycerol transferase I function beyond what any single method could achieve.

How does the activity of recombinant Phosphoglycerol transferase I from Salmonella newport compare to that of other bacterial species?

Comparative studies of Phosphoglycerol transferase I from different bacterial species reveal both conserved and species-specific properties:

Bacterial SpeciesGene NomenclatureSubcellular LocalizationSubstrate Specificity
Salmonella newportmdoB/opgB (SNSL254_A4896)Inner membranePhosphatidylglycerol → MDO
Escherichia colimdoB/opgB (ECSE_4635)Inner cytoplasmic membranePhosphatidylglycerol → MDO
Xanthomonas campestrisopgBInner membraneLikely similar to other species
Other Salmonella speciesmdoB/opgB (species-specific loci)Inner membranePhosphatidylglycerol → MDO

While the core enzymatic function appears conserved across species, subtle differences in substrate specificity, regulation, and activity levels may exist . These variations could reflect adaptations to different ecological niches and physiological requirements among bacterial species. Research comparing the three-dimensional structures and kinetic parameters of the enzymes from different sources would provide valuable insights into these potential differences.

What are the implications of mdoB function for bacterial pathogenesis and antibiotic resistance?

The relationship between Phosphoglycerol transferase I function and bacterial pathogenesis, particularly in the context of multidrug-resistant (MDR) Salmonella Newport, presents a compelling research area:

  • Membrane integrity and antibiotic permeability:

    • Modifications to MDOs through phosphoglycerol addition may affect membrane permeability barriers

    • Changes in membrane structure could influence the uptake and effectiveness of antibiotics

  • Environmental stress adaptation:

    • Proper MDO modification may contribute to bacterial survival under various stress conditions encountered during infection

    • Osmotic regulation through modified periplasmic components could enhance pathogen persistence

  • Multidrug resistance connection:

    • While not directly linked in the literature, there is a notable coincidence between the enzyme's presence in Salmonella Newport and the emergence of multidrug-resistant strains

    • The potential role of membrane modifications in drug resistance mechanisms warrants further investigation

  • Potential therapeutic targeting:

    • Given its specific role in bacterial physiology, Phosphoglycerol transferase I represents a potential target for novel antimicrobial development

    • Inhibitors of this enzyme could potentially sensitize resistant bacteria to existing antibiotics

These implications highlight the importance of understanding mdoB function beyond its biochemical mechanism, extending to its role in bacterial pathophysiology and clinical relevance.

What purification strategies yield the highest activity for recombinant Phosphoglycerol transferase I?

Optimal purification of recombinant Phosphoglycerol transferase I requires careful consideration of its membrane-associated nature:

  • Initial expression considerations:

    • Selection of appropriate expression tags (His, GST, etc.) that don't interfere with membrane association

    • Optimization of induction parameters to avoid inclusion body formation

    • Consideration of membrane-targeted expression systems

  • Membrane extraction:

    • Gentle cell lysis methods to preserve native membrane fragments

    • Selective detergent solubilization trials (e.g., non-ionic detergents like DDM, Triton X-100)

    • Potential use of amphipols or nanodiscs for maintaining membrane environment

  • Chromatographic purification:

    • Initial capture via affinity chromatography (if tagged)

    • Ion exchange chromatography exploiting the protein's charge properties

    • Size exclusion chromatography as a polishing step

  • Activity preservation:

    • Inclusion of phospholipids in purification buffers

    • Addition of 2-mercaptoethanol to prevent oxidation

    • Careful control of pH and ionic strength throughout purification

Standard protocols achieve ≥85% purity as determined by SDS-PAGE , but higher purity levels may be required for certain applications like structural studies or enzymatic mechanism investigations.

What are the key methodological challenges in studying Phosphoglycerol transferase I function?

Researchers face several significant methodological challenges when investigating Phosphoglycerol transferase I:

  • Membrane protein-specific challenges:

    • Maintaining native conformation during solubilization and purification

    • Distinguishing between detergent effects and intrinsic protein properties

    • Accurate quantification in membrane preparations

  • Enzymatic assay limitations:

    • Need for suitable substrate preparation (both phosphatidylglycerol and MDOs)

    • Developing high-throughput compatible activity assays

    • Distinguishing enzyme activity from non-enzymatic phospholipid transfer

  • Structural analysis difficulties:

    • Obtaining crystals suitable for X-ray diffraction

    • Challenges in membrane protein NMR spectroscopy

    • Interpreting structural data in the context of a membrane environment

  • In vivo relevance assessment:

    • Creating mutations that specifically affect activity without disrupting protein folding

    • Distinguishing direct from indirect effects in knockout studies

    • Correlating in vitro biochemical data with in vivo physiological significance

Addressing these challenges requires a combination of classical biochemical approaches, modern biophysical techniques, and genetic tools, often necessitating interdisciplinary collaboration.

What are emerging research questions regarding Phosphoglycerol transferase I in bacterial physiology?

Several compelling research directions are emerging for Phosphoglycerol transferase I investigation:

  • Structural biology:

    • Determination of high-resolution three-dimensional structure

    • Elucidation of substrate binding sites and catalytic mechanism

    • Structural comparison across bacterial species

  • Systems biology integration:

    • Understanding regulatory networks controlling mdoB expression

    • Mapping interactions between MDO modifications and other cellular processes

    • Quantitative models of membrane homeostasis incorporating phosphoglycerol transfer

  • Pathogenesis connections:

    • Role in host-pathogen interactions, particularly for Salmonella Newport

    • Contribution to biofilm formation and environmental persistence

    • Relationship to virulence in animal infection models

  • Antimicrobial development:

    • High-throughput screening for specific inhibitors

    • Structure-based design of phosphoglycerol transferase I inhibitors

    • Combination therapy approaches targeting membrane integrity

  • Evolutionary perspectives:

    • Phylogenetic analysis of mdoB/opgB genes across bacterial species

    • Adaptive significance of phosphoglycerol modification of MDOs

    • Horizontal gene transfer patterns and implications for bacterial evolution

These research directions highlight the multifaceted significance of Phosphoglycerol transferase I beyond its basic enzymatic function, pointing to its broader importance in bacterial biology and potential clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.