Recombinant Salmonella newport Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to ArnE and Its Role in Bacterial Pathogenesis

ArnE is a critical subunit of a heteromeric flippase complex (ArnE/F) in Salmonella enterica serovar Newport, a pathogen associated with foodborne infections and antimicrobial resistance . This protein facilitates the translocation of undecaprenyl phosphate (UndP)-linked 4-amino-4-deoxy-L-arabinose (L-Ara4N) across the inner membrane, a key step in lipid A modification for polymyxin resistance . The recombinant ArnE protein has been engineered for structural and functional studies to elucidate its role in bacterial survival and virulence.

Functional Role in L-Ara4N Biosynthesis and Resistance

ArnE operates within the Arn operon, which synthesizes L-Ara4N and attaches it to lipid A via a coordinated process:

  1. Undecaprenyl Phosphate Activation: ArnC attaches L-Ara4N to UndP .

  2. Flipping: ArnE/F translocates UndP-L-Ara4N to the outer leaflet .

  3. Transfer to Lipid A: ArnT transfers L-Ara4N to lipid A, reducing membrane charge and conferring polymyxin resistance .

Key Findings:

  • Resistance Mechanism: ArnE’s flipping activity is essential for lipid A modification, a hallmark of polymyxin-resistant Salmonella strains .

  • Heterodimeric Interaction: ArnE requires ArnF (formerly PmrL) for stability and function, akin to P4 ATPase flippase complexes in eukaryotes .

  • Structural Insights: Homology to P4 ATPases suggests a conserved "E2P" conformational cycle, where ATP hydrolysis drives lipid translocation .

Table 1: Recombinant ArnE Protein Characteristics

ParameterValue/Description
GenBank AccessionQ7UC61 (partial sequence)
Expression HostE. coli BL21(DE3)
Activity AssayCo-expression with ArnF in E. coli to restore lipid A modification
Antibody ReagentsAnti-His tag for Western blot confirmation

Functional Assays

  • Lipid A Modification: ArnE-deficient mutants show impaired L-Ara4N incorporation into lipid A, sensitizing cells to polymyxin .

  • Interaction Studies: Co-purification with ArnF confirms subunit dependency .

Comparison with Other Flippase Systems

ArnE shares functional and structural parallels with eukaryotic P4 ATPases but differs in substrate specificity and regulatory mechanisms:

FeatureArnE (Bacterial)Drs2p-Cdc50p (Yeast)
SubstrateUndP-L-Ara4NPhosphatidylserine (PS)
Regulatory PartnersArnFCdc50p
Membrane LocalizationInner membraneGolgi/Endosomes
Disease RelevancePolymyxin resistanceApoptosis, cell polarity

Data:

Implications for Therapeutic Targeting

ArnE’s role in antimicrobial resistance makes it a candidate for inhibitor development. Structural studies (e.g., cryo-EM of related flippases) could guide the design of small molecules disrupting UndP-L-Ara4N flipping .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; SNSL254_A2487; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
arnE
Target Protein Sequence
MIGVILVLASLLSVGGQLCQKQATRPLTAGGRRRHLMLWLGLALICMGAAMVLWLLVLQT LPVGIAYPMLSLNFVWVTLAAWKIWHEQVPPRHWLGVALIISGIIILGSAA
Uniprot No.

Target Background

Function
ArnE functions as a translocator, moving 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasm to the periplasmic side of the inner membrane.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ArnE protein in Salmonella Newport and what is its significance in antimicrobial resistance research?

The ArnE protein in Salmonella Newport functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex. This membrane protein is part of the arnBCADTEF operon (also known as pmrHFIJKLM in some literature), which is responsible for modifying lipopolysaccharide (LPS) with 4-amino-4-deoxy-L-arabinose (L-Ara4N). This modification is crucial for resistance to cationic antimicrobial peptides and certain antibiotics, particularly polymyxins and aminoglycosides.

The significance of ArnE in Salmonella Newport lies in its contribution to antimicrobial resistance mechanisms. Multidrug-resistant (MDR) Salmonella Newport strains, particularly those with the MDR-AmpC phenotype, have become a major global public health concern . The resistance mechanisms in these strains often involve multiple systems, and membrane modifications through proteins like ArnE represent an important area of study for understanding how bacteria evade antibiotic action.

Research on ArnE provides valuable insights into bacterial adaptation mechanisms and potential targets for new therapeutic strategies. The protein's role in LPS modification directly impacts the bacterial cell's permeability to antibiotics, making it a significant factor in resistance patterns observed in clinical isolates.

How does Salmonella Newport ArnE relate to the various lineages identified in population structure studies?

Salmonella Newport has been identified to fall into three distinct lineages (Newport-I, Newport-II, and Newport-III), each containing multiple sequence types (STs) with different antimicrobial resistance profiles . These lineages show geographic and host-specific distribution patterns that may influence the expression and function of proteins like ArnE.

Newport-II lineage is particularly notable in the context of ArnE research as it is preferentially associated with animals and encompasses the MDR-AmpC isolates. Two specific sequence types (STs) within Newport-II contain all MDR-AmpC isolates, suggesting a global spread after acquisition of resistance genes . This lineage would be most relevant for studying ArnE's role in antimicrobial resistance, as membrane modifications are likely to be more pronounced in these highly resistant strains.

In contrast, Newport-III isolates, which are predominantly found in humans in North America, tend to be pansusceptible to antibiotics . This presents an interesting comparative model for researchers to study differences in ArnE expression and function between resistant and susceptible lineages. The Newport-I lineage has fewer sequence types and appears to have emerged more recently, being more prevalent among humans in Europe than in North America .

Understanding these lineage-specific differences is essential when designing experiments involving ArnE, as its expression, structure, and function may vary depending on the genetic background of the strain being studied.

What genetic techniques are most appropriate for confirming the identity and expression of recombinant Salmonella Newport ArnE?

When working with recombinant Salmonella Newport ArnE, researchers should employ a multi-faceted approach to confirm both gene identity and protein expression. Starting with nucleotide-based confirmation, PCR amplification using gene-specific primers targeting the arnE gene provides initial verification. This should be followed by DNA sequencing of the amplified product to confirm the exact sequence matches the expected arnE gene from Salmonella Newport.

For more detailed genetic characterization, researchers might employ multilocus sequence typing (MLST) or the newer CRISPR-multi-virulence-locus sequence typing (CRISPR-MVLST) methods. These approaches have demonstrated high discriminatory abilities (>0.95) in distinguishing different Salmonella Newport strains . CRISPR-MVLST has proven particularly useful for tracking specific strains during outbreaks and could help confirm the lineage origins of the arnE gene being studied .

For protein expression confirmation, Western blotting using antibodies specific to ArnE (or to an epitope tag if one has been added to the recombinant construct) should be employed. Mass spectrometry-based approaches such as LC-MS/MS provide definitive confirmation of the protein identity and can also identify any post-translational modifications that may be present.

RNA-based methods including RT-PCR and RNA-Seq can provide information about arnE transcript levels, which is particularly useful when comparing expression across different growth conditions or in response to antibiotic challenge. This approach has been successfully used to study other membrane proteins involved in antimicrobial resistance in Salmonella .

How does the structure of ArnE contribute to the flippase function in the context of antimicrobial resistance?

The ArnE protein functions as a membrane component of the flippase complex that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (Ara4N-P-undecaprenol) from the cytoplasmic face to the periplasmic face of the inner membrane. This translocation is a critical step in the pathway that leads to the modification of lipid A with Ara4N, which reduces the negative charge of the bacterial outer membrane and decreases its affinity for cationic antimicrobial peptides and certain antibiotics.

Structurally, ArnE is predicted to contain multiple transmembrane domains that form a hydrophilic channel through which the polar head group of Ara4N-P-undecaprenol can pass while keeping the hydrophobic undecaprenol tail within the lipid bilayer. This protein works in concert with ArnF, forming a heterodimeric complex that constitutes the functional flippase. The precise arrangement of transmembrane helices creates a pathway that shields the charged portions of the substrate from the hydrophobic environment of the membrane interior.

The structure-function relationship of ArnE is particularly relevant in the context of MDR Salmonella Newport strains. While most isolates of multidrug-resistant Salmonella Newport are resistant to ampicillin, ciprofloxacin, and trimethoprim-sulfamethoxazole, they often remain susceptible to ceftriaxone . This variable susceptibility pattern may reflect differences in the efficiency of membrane modification systems, including the ArnE-dependent pathway. Researchers hypothesize that conformational changes in the ArnE protein structure could affect the efficiency of Ara4N incorporation into lipid A, thereby modulating the level of resistance to different antibiotics.

Experimental approaches to studying ArnE structure include cryo-electron microscopy, X-ray crystallography (though challenging for membrane proteins), and molecular dynamics simulations based on homology models. Cross-linking studies combined with mass spectrometry can also provide insights into the spatial arrangement of ArnE relative to other components of the Arn pathway.

What are the specific methodologies for studying interactions between ArnE and other proteins in the arnBCADTEF operon?

Studying protein-protein interactions within membrane-associated complexes like the arnBCADTEF operon requires specialized methodologies that account for the hydrophobic nature of these proteins. Several complementary approaches can be employed:

Bacterial Two-Hybrid Systems: Modified specifically for membrane proteins, bacterial two-hybrid assays can detect interactions between ArnE and other Arn proteins. This system involves fusing potential interacting partners to complementary fragments of a reporter protein that, when brought together through protein interaction, reconstitute activity that can be measured.

Co-immunoprecipitation with Membrane-Specific Detergents: When studying ArnE interactions, researchers should optimize detergent conditions (typically mild non-ionic detergents like DDM or LMNG) to solubilize membrane proteins while preserving native interactions. Antibodies against ArnE or epitope-tagged versions can then be used to pull down the protein complex, followed by proteomics analysis to identify interacting partners.

FRET/BRET Assays: Förster/Bioluminescence Resonance Energy Transfer techniques are particularly valuable for studying membrane protein interactions in their native environment. By tagging ArnE and potential partners with appropriate fluorophores or luciferase, researchers can detect proximity-based energy transfer when proteins interact within the membrane.

Chemical Cross-linking Coupled with Mass Spectrometry: This approach involves using membrane-permeable cross-linking agents to covalently link interacting proteins, followed by digestion and mass spectrometry analysis to identify the cross-linked peptides. This method can provide information about not only the interacting partners but also the specific regions involved in the interaction.

Split-Ubiquitin Membrane Yeast Two-Hybrid System: This specialized variant of the yeast two-hybrid system is designed specifically for membrane proteins and can be applied to study ArnE interactions with other components of the arn operon.

When investigating these interactions, it's important to consider the different lineages of Salmonella Newport, as genetic variations between lineages may affect protein-protein interactions. The Newport-II lineage, which is associated with multidrug resistance, would be particularly relevant for studying functional interactions related to antibiotic resistance mechanisms .

How do mutations in ArnE affect the antimicrobial resistance profile of Salmonella Newport, particularly against polymyxins and aminoglycosides?

Mutations in the ArnE protein can significantly alter the antimicrobial resistance profile of Salmonella Newport, particularly against polymyxins and aminoglycosides, which target bacterial membranes. The effects of these mutations can be analyzed through several systematic approaches:

Site-Directed Mutagenesis Studies: Targeted mutations in conserved domains of ArnE can reveal which residues are critical for function. Mutations affecting transmembrane domains may disrupt the flippase channel structure, while those in cytoplasmic or periplasmic loops might interfere with interactions with other proteins in the pathway or with substrate recognition.

Minimum Inhibitory Concentration (MIC) Analyses: Comprehensive antimicrobial susceptibility testing of ArnE mutants reveals patterns of cross-resistance or collateral sensitivity. Wild-type and mutant strains should be tested against a panel of antibiotics including polymyxins (colistin, polymyxin B), aminoglycosides (gentamicin, amikacin), and other classes to establish complete resistance profiles.

Polymyxin Binding Assays: Fluorescently-labeled polymyxins can be used to quantify binding to the bacterial outer membrane. ArnE mutations that reduce Ara4N incorporation typically result in increased polymyxin binding due to the more negatively charged membrane surface.

Competition and Fitness Studies: In vitro and in vivo competition experiments between wild-type and ArnE mutant strains can reveal fitness costs associated with specific mutations. Some mutations may increase susceptibility to antibiotics but also confer a growth advantage in the absence of selection pressure, similar to what has been observed with the FraB gene in Salmonella .

Research has demonstrated that the Newport-II lineage, which encompasses the MDR-AmpC isolates, shows distinct resistance patterns compared to Newport-III isolates, which are generally pansusceptible to antibiotics . This lineage-specific variation provides an important context for interpreting the effects of ArnE mutations, as the genetic background may influence how these mutations manifest in terms of resistance phenotypes.

What expression systems are optimal for producing recombinant Salmonella Newport ArnE for structural and functional studies?

The expression of recombinant membrane proteins like ArnE presents significant challenges due to their hydrophobic nature and the need for proper insertion into membranes. For researchers studying Salmonella Newport ArnE, several expression systems offer distinct advantages:

E. coli-Based Systems:

  • BL21(DE3) derivatives with enhanced membrane protein expression capabilities (C41, C43, Lemo21) provide good starting points for ArnE expression

  • Codon-optimized constructs are essential when expressing Salmonella genes in E. coli to overcome codon bias issues

  • Induction conditions must be carefully optimized: lower temperatures (16-20°C), reduced IPTG concentrations (0.1-0.5 mM), and extended expression times (16-24 hours) typically yield better results for membrane proteins

  • The pET expression system with a C-terminal His10 tag often provides better results than N-terminal tags for membrane proteins like ArnE

Cell-Free Expression Systems:

  • Membrane protein-optimized cell-free systems using nanodiscs or liposomes can provide properly folded ArnE in a membrane environment

  • These systems allow incorporation of detergents or lipids during translation, potentially improving protein folding

  • While yields are typically lower than cell-based systems, the protein quality is often superior for functional studies

Yeast Expression Systems:

  • Pichia pastoris can be advantageous for expressing membrane proteins like ArnE due to its eukaryotic folding machinery and ability to grow to high cell densities

  • Careful optimization of methanol induction for pAOX1-based vectors is critical for successful expression

Table 1: Comparison of Expression Systems for Recombinant Salmonella Newport ArnE

Expression SystemAdvantagesLimitationsTypical YieldBest Applications
E. coli BL21(DE3)Fast growth, easy manipulationPotential inclusion body formation0.5-2 mg/LInitial screening
E. coli C41/C43Reduced toxicity for membrane proteinsLower expression levels0.2-1 mg/LFunctional studies
Cell-free systemRapid, direct incorporation into membranesHigh cost, lower yield0.1-0.5 mg/LStructural studies
Pichia pastorisHigh cell density, proper foldingSlow growth, complex manipulation1-5 mg/LLarge-scale production

For functional studies, it's crucial to confirm that the recombinant ArnE is properly folded and inserted into the membrane. This can be assessed through activity assays measuring Ara4N translocation or through structural characterization techniques such as circular dichroism spectroscopy to analyze secondary structure components. Researchers should also verify that the expressed protein doesn't significantly differ from the native form found in Salmonella Newport strains, particularly those from the multidrug-resistant lineages .

What are the most effective purification strategies for recombinant Salmonella Newport ArnE?

Purifying membrane proteins like ArnE requires specialized approaches that maintain protein stability while removing the protein from its native lipid environment. A systematic purification protocol for Salmonella Newport ArnE would include the following sequential steps:

Membrane Extraction and Solubilization:

  • After cell disruption (typically by sonication or high-pressure homogenization), membrane fractions are isolated through differential centrifugation

  • Critical comparison of detergents is essential: mild non-ionic detergents (DDM, LMNG, or UDM at 1-2% w/v) typically preserve ArnE structure and function better than harsh ionic detergents

  • Solubilization should occur at 4°C for 1-2 hours with gentle agitation, followed by ultracentrifugation to remove insoluble material

Affinity Chromatography:

  • For His-tagged ArnE, IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA or TALON resins provides the initial purification step

  • Buffer composition is critical: including glycerol (10-20%), salt (150-300 mM NaCl), and a low concentration of detergent (typically 2-3× CMC) helps maintain protein stability

  • A step gradient elution with imidazole (50, 100, 250, and 500 mM) can separate differentially binding contaminants

Size Exclusion Chromatography:

  • SEC as a polishing step separates monomeric ArnE-detergent complexes from aggregates and other contaminants

  • Superdex 200 or Superose 6 columns are typically most appropriate for membrane proteins like ArnE

  • Flow rates should be kept low (0.3-0.5 ml/min) to improve resolution

Detergent Exchange and Concentration:

  • For structural studies, exchanging the initial solubilization detergent for a more suitable one (like LMNG or GDN for cryo-EM studies) may be necessary

  • Concentration should be performed using centrifugal concentrators with appropriate molecular weight cutoffs (50-100 kDa) to account for the detergent micelle size

Table 2: Detergent Screening for Salmonella Newport ArnE Purification

DetergentCMC (mM)Micelle Size (kDa)Protein StabilityFunctional ActivityBest Application
DDM0.17~70++++++General purification
LMNG0.01~30++++++Cryo-EM studies
UDM0.59~50++++++Functional assays
Digitonin0.5~70+++++Structural studies
GDN0.01~25+++++++Crystallography

Throughout the purification process, samples should be analyzed by SDS-PAGE, Western blotting, and activity assays to track protein yield, purity, and functionality. For ArnE, which functions as part of a complex with ArnF, co-purification strategies may be necessary to maintain functional activity. This could involve co-expression of both proteins or reconstitution experiments after purification.

The choice of purification strategy should be guided by the intended downstream application. For structural studies, higher purity requirements may necessitate additional chromatography steps, while functional studies might prioritize maintaining native-like lipid composition around the protein.

What functional assay methodologies can accurately measure ArnE flippase activity in vitro?

Measuring the flippase activity of ArnE presents significant challenges due to its function of translocating lipid-linked substrates across membranes. Several methodologies have been developed to accurately assess this activity in vitro:

Reconstituted Proteoliposome-Based Assays:

  • Purified ArnE (ideally co-purified with ArnF) is reconstituted into liposomes with defined lipid composition

  • Fluorescently labeled Ara4N-P-undecaprenol analogues can be incorporated into the outer leaflet

  • Flippase activity is measured by monitoring the movement of the fluorescent substrate to the inner leaflet using fluorescence quenching techniques

  • Controls should include protein-free liposomes and liposomes containing inactive ArnE mutants

NBD-Labeled Lipid Flipping Assays:

  • NBD-labeled phospholipid analogues that mimic the native substrate can be used as reporter molecules

  • Dithionite-mediated fluorescence quenching allows selective quenching of NBD fluorescence in the outer leaflet

  • The rate of fluorescence reduction after dithionite addition correlates with flippase activity

  • This method has been successfully applied to similar bacterial flippases and could be adapted for ArnE

Mass Spectrometry-Based Approaches:

  • Proteoliposomes containing ArnE are incubated with the native substrate Ara4N-P-undecaprenol

  • At defined time points, inner and outer leaflets are selectively labeled using membrane-impermeable reagents

  • Lipids are extracted and analyzed by LC-MS/MS to quantify substrate translocation

  • This approach offers high specificity but requires sophisticated analytical equipment

FRET-Based Real-Time Assays:

  • FRET donor and acceptor fluorophores are incorporated into the substrate and membrane, respectively

  • Changes in FRET efficiency occur when the substrate changes orientation or position in the membrane

  • This method allows continuous real-time monitoring of flippase activity

  • Multiple substrate concentrations should be tested to determine kinetic parameters (Km, Vmax)

When establishing these assays, researchers should consider several experimental variables:

  • Lipid composition of proteoliposomes significantly affects flippase activity

  • pH and ionic strength of the assay buffer must be optimized

  • Temperature affects both membrane fluidity and enzyme kinetics

  • Detergent residues from purification can compromise membrane integrity

Table 3: Comparison of ArnE Functional Assay Methods

Assay MethodSensitivityThroughputTechnical ComplexityEquipment RequirementsKey Advantages
Reconstituted proteoliposomesHighLowHighFluorometer, ultracentrifugeMost physiologically relevant
NBD-lipid flippingMediumMediumMediumFluorometerReal-time measurements
Mass spectrometryVery highLowVery highLC-MS/MSDirect substrate measurement
FRET-basedHighMediumHighTime-resolved fluorometerContinuous monitoring

These methodologies should be applied comparatively when studying ArnE variants from different Salmonella Newport lineages, as subtle differences in activity might explain the varying resistance profiles observed between Newport-II (MDR-AmpC) and Newport-III (generally pansusceptible) isolates .

How should researchers interpret contradictory results when studying the effect of ArnE mutations on antimicrobial resistance?

When researchers encounter contradictory results in studies of ArnE mutations and their effects on antimicrobial resistance in Salmonella Newport, a systematic analytical framework should be employed to reconcile these discrepancies:

Genetic Background Analysis:
Contradictory phenotypes may result from strain-specific genetic factors. Salmonella Newport comprises three distinct lineages with different antimicrobial resistance profiles . A mutation that increases resistance in a Newport-II background might have minimal effect in Newport-III strains due to lineage-specific genetic interactions. Complete genome sequencing of the strains used should be performed to identify potential modifier genes or compensatory mutations that could explain divergent results.

Experimental Condition Variability:
Antimicrobial susceptibility testing methods can significantly impact results. MIC determinations by broth microdilution versus agar dilution may yield different values for the same strain. Additionally, media composition, incubation temperature, and inoculum size all influence measured resistance levels. When reconciling contradictory results, researchers should:

  • Standardize testing conditions across experiments

  • Compare results using multiple methodologies (e.g., MIC, time-kill assays, population analysis profiling)

  • Evaluate resistance under conditions that mimic relevant in vivo environments

Expression Level Considerations:
Contradictory findings may stem from differences in ArnE expression levels. Quantitative RT-PCR or RNA-Seq should be employed to measure arnE transcript levels, while Western blotting can quantify protein levels. Mutations may affect protein stability or transcriptional regulation rather than intrinsic activity, explaining why functional effects might vary between studies.

Interacting Resistance Mechanisms:
ArnE functions within a complex network of resistance mechanisms. Contradictory results may reflect different interactions with other resistance systems. For example, the MDR-AmpC phenotype common in Newport-II lineage isolates includes resistance to multiple antibiotics including third-generation cephalosporins . The effect of ArnE mutations might be masked or amplified depending on which other resistance mechanisms are active in the strains being compared.

Statistical Approach to Contradictory Data:
When faced with contradictory datasets, researchers should:

  • Perform meta-analysis when multiple studies are available

  • Use Bayesian approaches to incorporate prior knowledge about ArnE function

  • Apply multivariate statistical methods to identify patterns across seemingly contradictory results

  • Consider employing machine learning techniques to identify complex relationships between genetic factors and resistance phenotypes

Table 4: Framework for Resolving Contradictory Results in ArnE Studies

Source of ContradictionAnalytical ApproachExperimental ValidationStatistical Method
Genetic background differencesWhole genome comparisonComplementation studies, allelic exchangePrincipal component analysis
Methodological variationProtocol standardizationMulti-method testing of same strainsBland-Altman analysis
Expression level differencesTranscriptome/proteome analysisControlled expression systemsCorrelation analysis
Interacting resistance mechanismsNetwork analysisCombinatorial gene deletionsMultiple regression
Environmental conditionsSystematic condition variationIn vitro vs. in vivo testingTwo-way ANOVA

By systematically addressing these potential sources of contradiction, researchers can develop a more nuanced understanding of ArnE's role in antimicrobial resistance, accounting for lineage-specific effects and interactions with other resistance mechanisms observed in Salmonella Newport strains .

What bioinformatic approaches can predict the impact of ArnE sequence variations on resistance phenotypes?

Predicting how ArnE sequence variations affect antimicrobial resistance phenotypes in Salmonella Newport requires sophisticated bioinformatic approaches that integrate multiple data types and analytical methods:

Sequence-Based Prediction Methods:

  • Conservation analysis across Salmonella species identifies highly conserved residues likely critical for function

  • Multiple sequence alignment with other flippase proteins can identify functional domains

  • Algorithms such as SIFT, PolyPhen-2, and PROVEAN can predict the functional impact of amino acid substitutions based on evolutionary conservation and physicochemical properties

  • These predictions should be weighted by the degree of conservation across Newport lineages, with stronger predictions for residues conserved across all three major lineages (Newport-I, Newport-II, and Newport-III)

Structural Prediction and Molecular Dynamics:

  • Homology modeling using related bacterial flippases as templates can generate ArnE structural models

  • In silico mutagenesis combined with molecular dynamics simulations can predict how specific mutations affect protein stability and dynamics

  • Molecular docking simulations can model interactions between ArnE and its substrate or with ArnF

  • These approaches are particularly valuable for membrane proteins like ArnE where experimental structural determination is challenging

Machine Learning Integration:

  • Supervised learning algorithms trained on datasets of known resistance-associated mutations can predict the impact of novel variants

  • Features should include both sequence characteristics and structural predictions

  • Cross-validation using datasets from different Salmonella Newport lineages improves prediction accuracy for lineage-specific effects

  • Ensemble methods combining multiple prediction algorithms typically outperform single approaches

Genome-Wide Association Studies (GWAS):

  • GWAS approaches correlating genome-wide SNPs with resistance phenotypes can identify epistatic interactions with ArnE variants

  • These analyses require large datasets of sequenced Salmonella Newport isolates with well-characterized antimicrobial susceptibility profiles

  • Population structure correction is essential given the distinct lineages of Salmonella Newport

Network-Based Approaches:

  • Protein-protein interaction network analysis can predict how ArnE mutations might affect its interactions with other proteins in the arn operon

  • Metabolic network modeling can simulate the impact of altered ArnE function on lipopolysaccharide modification pathways

  • Gene regulatory network analysis can identify potential compensatory mechanisms that might be activated in response to reduced ArnE function

Table 5: Comparative Assessment of Bioinformatic Methods for ArnE Variant Analysis

MethodPrediction TargetRequired Input DataAccuracyComputational DemandsBest Use Case
SIFT/PolyPhenFunctional impact of substitutionsProtein sequenceMediumLowRapid screening of multiple variants
Homology modelingProtein structureSequence, template structuresMediumMediumVisualizing mutation locations
Molecular dynamicsConformational changes3D structureHighVery highDetailed analysis of specific mutations
Random forest MLResistance phenotypeSequence features, known phenotypesMedium-highMediumIntegrating multiple predictors
GWASAssociated genomic variantsWhole genome sequences, phenotypesMediumHighDiscovering novel associations
Network analysisSystem-level effectsInteraction data, expression dataMediumMediumUnderstanding compensatory mechanisms

These bioinformatic approaches should be validated using experimental data from different Salmonella Newport lineages. The MDR-AmpC Newport-II lineage isolates, which show resistance to multiple antibiotics , provide particularly valuable validation cases for predictions related to antimicrobial resistance phenotypes.

How can researchers design experiments to distinguish between direct and indirect effects of ArnE on various antimicrobial resistance mechanisms?

Distinguishing between direct effects of ArnE (through its flippase activity facilitating LPS modification) and indirect effects (through potential interactions with other resistance systems) requires carefully designed experimental approaches:

Genetic Manipulation Strategies:

  • Clean deletion and complementation: Create ΔarnE mutants and complement with wild-type or mutant alleles under controlled expression

  • Allelic replacement: Substitute native arnE with mutant versions to maintain natural gene context and expression

  • Conditional expression systems: Use inducible promoters to modulate ArnE levels and determine dose-dependent effects

  • Domain swapping: Replace specific domains of ArnE with corresponding regions from homologous proteins to identify functional regions

Biochemical Pathway Isolation:

  • Reconstituted systems: Express and purify components of the Arn pathway to reconstitute activity in vitro

  • Radiolabeled precursor tracking: Use radiolabeled substrates to follow the complete pathway of LPS modification

  • Intermediate accumulation analysis: Quantify pathway intermediates in wild-type versus arnE mutants to identify precise blockage points

  • These approaches have successfully identified specific roles of other enzymes in Salmonella resistance mechanisms, similar to strategies used for characterizing the FraB enzyme

Epistasis Analysis:

  • Create double mutants combining arnE mutations with alterations in other resistance genes

  • Quantify resistance phenotypes in single and double mutants to identify additive, synergistic, or antagonistic interactions

  • This approach can distinguish between ArnE functioning in parallel versus sequential pathways with other resistance mechanisms

Time-Resolved Studies:

  • Measure the kinetics of resistance development following antibiotic exposure in wild-type versus arnE mutants

  • Use time-course transcriptomics and proteomics to track global changes

  • Correlate temporal changes in LPS modification with resistance development

Sublethal Concentration Effects:

  • Examine bacterial responses to sublethal antibiotic concentrations with functional versus mutant ArnE

  • Monitor gene expression changes, particularly in stress response and resistance pathways

  • These studies can reveal whether ArnE plays a role in adaptive responses beyond its direct function in LPS modification

Table 6: Experimental Design to Distinguish Direct vs. Indirect ArnE Effects

Experimental ApproachControlsMeasurementsExpected Outcomes for Direct EffectsExpected Outcomes for Indirect Effects
Clean gene deletionEmpty vector, complementationMICs, growth kinetics, LPS profileSpecific resistance loss, restored by complementationBroad resistance changes, partial complementation
Pathway reconstitutionIndividual component omissionsIn vitro flipping activity, LPS modificationActivity directly proportional to ArnE levelsComplex relationship between ArnE and outcome
Double mutant analysisSingle mutantsEpistatic effects on resistanceIndependent effects with other pathwaysSynergistic effects with related pathways
Time-course studiesNon-antibiotic stressTemporal gene expression patternsEarly effects on LPS, later resistanceDelayed effects on resistance mechanisms
Sublethal concentrationGrowth rate-matched controlsGlobal transcriptional responseLimited gene expression changesBroad stress response alterations

These approaches should be conducted with strains representing different Salmonella Newport lineages, as the three major lineages (Newport-I, Newport-II, and Newport-III) show distinct antimicrobial resistance profiles . The Newport-II lineage, which encompasses MDR-AmpC isolates resistant to multiple antibiotics including third-generation cephalosporins, would be particularly valuable for these investigations .

What novel therapeutic approaches targeting ArnE or related flippase proteins show promise for combating multidrug-resistant Salmonella Newport?

The emergence of multidrug-resistant Salmonella Newport strains has created an urgent need for novel therapeutic approaches. ArnE and related flippase proteins represent promising targets due to their essential role in antimicrobial resistance mechanisms and their limited presence in human cells. Several innovative therapeutic strategies show potential:

Small-Molecule Flippase Inhibitors:

  • High-throughput screening approaches similar to those used to identify FraB inhibitors could identify compounds that specifically inhibit ArnE

  • Structure-activity relationship studies to optimize lead compounds for potency and specificity

  • Rational drug design based on structural models of ArnE-substrate interactions

  • Combination therapy with existing antibiotics could restore effectiveness against resistant strains

Peptide-Based Inhibitors:

  • Designed peptides that mimic natural ArnE interaction surfaces could disrupt protein-protein interactions within the Arn complex

  • Cell-penetrating antimicrobial peptides could be engineered to specifically target bacteria with modified LPS due to ArnE activity

  • These approaches could exploit the differences between Newport lineages in terms of membrane composition and architecture

Genetic Approaches:

  • CRISPR-Cas delivery systems specifically targeting arnE could selectively eliminate resistant bacteria

  • Antisense oligonucleotides designed to inhibit arnE expression

  • These genetic approaches must account for the three distinct lineages of Salmonella Newport and target conserved regions

Immunological Strategies:

  • Vaccines targeting surface epitopes that become exposed in arnE mutants

  • Monoclonal antibodies that recognize specific LPS modifications dependent on ArnE function

  • Immunomodulators that enhance host defenses against Salmonella with compromised membrane integrity

Alternative Flippase Substrates:

  • Substrate analogues that compete with natural ArnE substrates but lead to non-functional LPS modifications

  • "Trojan horse" approaches where modified substrates are flipped but then disrupt membrane integrity

  • These approaches are particularly promising as they exploit the natural function of ArnE rather than inhibiting it

Table 7: Emerging Therapeutic Approaches Targeting Flippase Proteins

Therapeutic ApproachDevelopment StageAdvantagesChallengesPotential Impact on MDR Newport
Small-molecule inhibitorsPreclinicalOral bioavailability, scalable productionMembrane penetration issuesHigh for specific inhibitors
Peptide-based inhibitorsEarly researchHigh specificity, low toxicityStability and delivery issuesModerate to high
CRISPR-Cas systemsEarly researchHighly specific targetingDelivery to infection siteHigh but limited by delivery
Immunological approachesConceptualHost-mediated clearanceStrain variationModerate
Substrate analoguesEarly researchUtilizes bacterial machineryComplex synthesisHigh for broad-spectrum analogues

The development of these approaches should consider the distinct lineages of Salmonella Newport. Research has shown that Newport-II lineage, which is associated with multidrug resistance and the MDR-AmpC phenotype, would be the primary target for such therapeutics . Additionally, these approaches should be evaluated in the context of existing treatment protocols for multidrug-resistant Salmonella Newport infections, which currently rely heavily on ceftriaxone as most isolates remain susceptible to this antibiotic despite resistance to many others .

How might advanced structural biology techniques advance our understanding of ArnE function and evolution across Salmonella Newport lineages?

Advanced structural biology techniques offer unprecedented opportunities to elucidate the molecular details of ArnE function and its evolutionary adaptations across Salmonella Newport lineages. These approaches can provide critical insights that inform both basic research and therapeutic development:

Cryo-Electron Microscopy (Cryo-EM):

  • Single-particle cryo-EM can resolve ArnE structure in different conformational states during the flipping cycle

  • Cryo-electron tomography can visualize ArnE in its native membrane environment and reveal its organization relative to other components of the LPS modification machinery

  • These approaches are particularly valuable for comparing ArnE structures across the three Salmonella Newport lineages (Newport-I, Newport-II, and Newport-III) , potentially revealing structural adaptations associated with different resistance profiles

Integrative Structural Biology:

  • Combining multiple techniques (X-ray crystallography, NMR, SAXS, molecular dynamics) to build comprehensive structural models

  • Cross-linking mass spectrometry to map interaction surfaces between ArnE and partner proteins

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and substrate binding sites

  • These integrative approaches can reveal how sequence variations between Newport lineages translate to functional differences

Time-Resolved Structural Studies:

  • Time-resolved cryo-EM using microfluidic mixing devices to capture transient conformational states

  • Time-resolved FRET to monitor dynamic conformational changes during substrate flipping

  • These approaches could identify rate-limiting steps in the flipping mechanism that might be targeted therapeutically

In Situ Structural Biology:

  • Cellular cryo-electron tomography to visualize ArnE in its native membrane environment

  • Correlative light and electron microscopy to connect structural features with functional states

  • These techniques could reveal lineage-specific differences in membrane organization and protein localization

Evolutionary Structural Analysis:

  • Ancestral sequence reconstruction and structure prediction to trace the evolutionary history of ArnE

  • Structural analysis of ArnE variants from all three Newport lineages to identify adaptive changes

  • This evolutionary approach could provide insights into how structural variations contribute to the distinct antimicrobial resistance profiles observed in Newport lineages

Table 8: Advanced Structural Biology Approaches for ArnE Research

These structural approaches should be applied systematically across representative isolates from each of the three Salmonella Newport lineages to understand how structural variations contribute to their distinct antimicrobial resistance profiles . Such comparative structural biology would be particularly valuable for understanding the molecular basis of the MDR-AmpC phenotype associated with the Newport-II lineage .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.