Recombinant Salmonella newport Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella Newport Probable Intracellular Septation Protein A (YciB) is a bacterial protein produced through genetic engineering for research applications. YciB belongs to the DUF892 protein family and plays roles in membrane homeostasis, stress response, and cell division in Salmonella species . While functional studies primarily focus on homologs like S. Typhimurium YciB, its recombinant form in S. Newport enables targeted biochemical and structural analyses .

Protein Sequence and Domains

  • Full-length sequence: 223 amino acids (UniProt ID: B4T657) .

  • Key domains: Predicted transmembrane regions and conserved residues implicated in membrane protein interactions .

Table 1: Key Sequence Features of Recombinant S. Newport YciB

ParameterDetails
Molecular Weight~25 kDa (calculated)
Expression Region1-223 (full-length)
TagDetermined during production (commonly His-tag or GST-tag)
Post-Translational ModificationsNone reported; expressed in E. coli systems

Recombinant Production

  • Expression system: E. coli-based platforms .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C .

Role in Membrane Homeostasis

  • S. Typhimurium YciB interacts with DcrB to maintain lipid asymmetry and lipoprotein maturation .

  • Key mechanism: Attenuates Lgt-mediated transacylation, preventing toxic peptidoglycan-inner membrane linkages .

Table 2: Comparative Functional Roles of YciB Homologs

OrganismFunctionCitation
S. TyphimuriumRegulates lipoprotein trafficking; synthetic lethality with dcrB
E. coliMaintains membrane fluidity under stress

Stress Response

  • Bile stress: YciB homologs mitigate reactive oxygen species (ROS) by sequestering excess iron .

  • Oxidative stress: Ferroxidase activity observed in S. Typhimurium YciF (a paralog) suggests potential metal-binding roles for YciB .

Biochemical Assays

  • ELISA: Used to detect Salmonella antigens in clinical samples (e.g., Catalog #OPCA142728) .

  • Protein-protein interaction studies: Identifies partners in membrane homeostasis pathways .

Antibody Development

  • Recombinant YciB serves as an immunogen for polyclonal/monoclonal antibody production .

Challenges and Future Directions

  • Functional redundancy: YciB’s synthetic lethality with dcrB complicates genetic studies .

  • Structural data: No high-resolution structures available; cryo-EM studies are needed .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yciB; SNSL254_A1862; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKLYDIYAATSALIVATAIVLIYSWVRYRKIEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELALPQQVWSKLN LAWALFFIACGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHLPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of yciB in bacterial cell division?

Salmonella newport Probable intracellular septation protein A (yciB) is believed to participate in bacterial cell division by contributing to the formation of the divisome complex at the mid-cell. Based on current understanding of bacterial septation processes, yciB likely functions alongside other division proteins during the formation of the septum. Cell division in bacteria requires the assembly of a multi-protein complex called the divisome at the mid-cell to enable peptidoglycan synthesis and septation . As a probable septation protein, yciB would be part of this intricate machinery that coordinates cell wall synthesis during division.

How does yciB relate to other divisome proteins?

In bacterial cell division systems, proteins involved in septation typically interact with core components of the divisome such as FtsZ filaments, which play a dual role at the septum in recruiting other division proteins and generating contractile force necessary for constriction . While specific interaction patterns of yciB are not fully characterized, it likely operates within the network of proteins that includes FtsZ, FtsA, ZipA, and FtsEX. These proteins collectively form the Z-ring at the division plane, with FtsA and ZipA anchoring FtsZ filaments to the cytoplasmic membrane .

What structural features characterize yciB?

yciB is predicted to contain transmembrane domains characteristic of membrane-integrated septation proteins. Similar to other divisome-associated proteins, it may feature domains that facilitate protein-protein interactions within the divisome complex. The structural characteristics of yciB should be analyzed in relation to other septation proteins that have defined roles in divisome assembly.

What methodologies are recommended for studying yciB function in Salmonella newport?

Researchers investigating yciB should consider implementing a multi-faceted approach:

  • Gene knockout studies to observe phenotypic changes in cell division

  • Fluorescent protein tagging to visualize subcellular localization during division

  • Pull-down assays to identify protein-protein interactions within the divisome

  • Site-directed mutagenesis to identify critical functional residues

Similar approaches have been successfully used for characterizing other bacterial division proteins, as demonstrated in studies of FtsEX, which revealed that its ATPase activity is involved in the activation of septal peptidoglycan synthesis .

How might yciB contribute to peptidoglycan synthesis during septation?

Based on current understanding of bacterial septation, yciB may participate in coordinating peptidoglycan synthesis at the division site. In bacterial division systems, proteins like FtsW, a member of the SEDS (shape, elongation, division, and sporulation) family, function as transglycosylases that catalyze the addition of disaccharides containing NAG and NAM to existing peptidoglycan strands at the septum . yciB could potentially interact with such peptidoglycan synthetic machinery or contribute to its regulation during septation.

What techniques are most effective for studying yciB-protein interactions?

To effectively map yciB interactions within the divisome complex, researchers should consider:

  • Bacterial two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • FRET (Förster Resonance Energy Transfer) analysis

  • Cross-linking coupled with mass spectrometry

These approaches have successfully characterized interactions between divisome components, such as how FtsQ interacts with FtsB, FtsW, FtsI, and FtsN within the division machinery .

What expression systems yield optimal production of recombinant Salmonella newport yciB?

For effective recombinant expression of membrane-associated bacterial proteins like yciB:

  • Use E. coli expression systems with controllable promoters (T7, araBAD)

  • Consider membrane protein-optimized strains (C41/C43)

  • Employ fusion tags that enhance solubility (MBP, SUMO)

  • Optimize induction conditions (temperature, inducer concentration, time)

When working with recombinant membrane proteins, researchers should carefully balance expression levels to prevent toxicity while maintaining sufficient yield.

What purification strategies are most effective for recombinant yciB?

Purifying membrane proteins like yciB requires specialized approaches:

  • Detergent screening to identify optimal solubilization conditions

  • Affinity chromatography utilizing fusion tags (His, FLAG, GST)

  • Size exclusion chromatography for final polishing

  • Validation of protein folding through circular dichroism spectroscopy

This methodological approach should be tailored based on yciB's predicted structural properties and subcellular localization.

How can researchers validate the functional activity of purified recombinant yciB?

Functional validation could include:

  • In vitro peptidoglycan binding assays

  • Liposome reconstitution experiments

  • Complementation studies in yciB knockout strains

  • Structural studies (X-ray crystallography, cryo-EM) to determine protein conformation

Similar biochemical approaches have been used to characterize other bacterial proteins, such as YciF in Salmonella Typhimurium, where purified wild-type protein was shown to form higher-order oligomers and display specific enzymatic activity .

How might studying yciB contribute to addressing Salmonella Newport infections?

Understanding yciB's role in Salmonella newport could inform novel antimicrobial strategies, particularly given the public health significance of Salmonella Newport infections. Recent data shows ongoing outbreaks of Salmonella Newport infections under FDA investigation, with 27 confirmed patients reported as of February 20, 2025 . By targeting divisome components like yciB, researchers might develop interventions that disrupt bacterial replication.

What is the relevance of yciB research to antimicrobial resistance?

Septation proteins represent potential targets for developing antibiotics with novel mechanisms of action. Investigating yciB could reveal vulnerabilities in the divisome assembly that might be exploited therapeutically, addressing the growing concern of antimicrobial resistance in Salmonella Newport and other pathogens.

How does yciB function relate to antimicrobial peptides like Microcin J25?

Research into bacteriocins like Microcin J25 (MccJ25) has shown significant inhibitory activity against Salmonella Newport, with MICs and MBCs at 0.03 and 3.71 μM respectively . Understanding how antimicrobial peptides might interact with divisome components like yciB could provide insights into their mechanisms of action and potentially guide the development of more effective antimicrobial agents.

How conserved is yciB across different Salmonella serovars and related bacteria?

Analysis of yciB conservation could reveal evolutionary pressures on bacterial cell division machinery. Researchers should conduct:

  • Comprehensive sequence alignments across bacterial species

  • Phylogenetic analysis to trace evolutionary history

  • Structure prediction to identify conserved functional domains

  • Comparison of genetic contexts to identify conserved operonic structures

Similar comparative approaches have revealed important insights about other bacterial proteins like YciF in Salmonella Typhimurium, which belongs to the DUF892 domain family with wide taxonomic distribution encompassing several bacterial pathogens .

Table 1: Predicted Functional Domains in Salmonella newport yciB and Related Septation Proteins

ProteinPredicted Transmembrane DomainsKey Functional MotifsConservation Across Salmonella Species
yciB4-6 (typical for septation proteins)Membrane integration domainsHighly conserved
FtsZNone (cytoplasmic)GTP-binding domain, C-terminal interaction domainUniversally conserved
FtsAMembrane-tethering amphipathic helixATP-binding domainHighly conserved
FtsW10 (typical for SEDS family)Transglycosylase domainHighly conserved
FtsI/PBP3Single transmembrane domainTranspeptidase domainHighly conserved

Table 2: Comparative Analysis of Cell Division Machinery in Different Bacterial Species

Bacterial SpeciesKey Division ProteinsSeptation MechanismyciB Homolog Present?
Salmonella newportFtsZ, FtsA, ZipA, FtsW, FtsIBinary fission with Z-ringYes
Escherichia coliFtsZ, FtsA, ZipA, FtsW, FtsIBinary fission with Z-ringYes (high similarity)
Bacillus subtilisFtsZ, FtsA, EzrA, DivIBBinary fission with Z-ringYes (moderate similarity)
Staphylococcus aureusFtsZ, FtsA, EzrA, DivICBinary fission in multiple planesYes (low similarity)
Mycobacterium tuberculosisFtsZ, FtsW, Wag31Asymmetric divisionDistant homolog

Chart 1: Model of Divisome Assembly and yciB Integration During Bacterial Cell Division

(Conceptual flowchart showing sequential recruitment of divisome components)

  • Early assembly: FtsZ polymerization forms Z-ring at mid-cell

  • Z-ring stabilization: FtsA and ZipA anchor FtsZ to membrane

  • Intermediate assembly: FtsEX, FtsK proteins join complex

  • Late assembly: Peptidoglycan synthesis machinery (FtsW, FtsI) recruited

  • yciB integration: Probable incorporation alongside late divisome components

  • Septation completion: Peptidoglycan synthesis and daughter cell separation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.