Recombinant Salmonella newport Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
lgt; SNSL254_A3229; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPDFDPVIFSIGPVALHWYGLMYLVGFVFAMWLAVRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPLFLDNPLYLFRVWDGGMSFHGGLIGVILVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFRFAMLFPGSRAEDIALLPSH PQWQPIFDTYGVLPRHPSQLYELALEGVVLFIILNLFIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIIAGAIMMVWAYRRRPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, marking the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (Lgt) and what is its fundamental role?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins in Gram-negative bacteria, including Salmonella newport. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the cysteine residue of the lipobox motif in prolipoproteins . This modification is essential for subsequent processing steps in the lipoprotein maturation pathway, which ultimately produces mature lipoproteins that are crucial for bacterial cell envelope integrity and function .

The enzymatic reaction catalyzed by Lgt can be represented as:

Prolipoprotein + Phosphatidylglycerol → Diacylglyceryl-prolipoprotein + Glycerol-1-phosphate

In Salmonella newport, Lgt (UniProt: B4T4Z4) is encoded by the lgt gene (locus SNSL254_A3229) and consists of 291 amino acids . The protein contains multiple transmembrane segments that anchor it to the inner membrane, where it performs its catalytic function.

How does Lgt activity affect bacterial cell envelope integrity?

Lgt activity is critical for maintaining the structural integrity of the Gram-negative bacterial cell envelope through its role in lipoprotein biogenesis. When Lgt function is compromised, several detrimental effects occur:

  • Outer membrane permeabilization: Depletion of Lgt leads to significant disruption of the outer membrane barrier, increasing permeability to molecules that would normally be excluded .

  • Increased antibiotic sensitivity: Even partial depletion of Lgt (as little as 25%) can lead to increased sensitivity to antibiotics that normally cannot penetrate the Gram-negative outer membrane .

  • Vulnerability to serum killing: Bacteria with reduced Lgt function show increased susceptibility to complement-mediated killing, even in normally serum-resistant strains like E. coli CFT073 .

  • Altered cell morphology: Lgt depletion causes increases in cell size and induces an Lpp-dependent inner membrane contraction due to osmotic stress .

These effects collectively highlight why Lgt is essential for bacterial viability and represents a potential antimicrobial target.

What are optimal conditions for handling recombinant Salmonella newport Lgt?

For successful experimental work with recombinant Salmonella newport Lgt, researchers should consider the following handling recommendations:

  • Storage conditions:

    • Store at -20°C for routine use

    • For extended storage, maintain at -80°C

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer composition:

    • Optimally maintained in Tris-based buffer with 50% glycerol

    • Buffer composition may need optimization specific to the particular recombinant protein preparation

  • Stability considerations:

    • Avoid repeated freeze-thaw cycles as they can compromise protein activity

    • Consider single-use aliquots to maintain protein integrity

  • Activity preservation:

    • Include reducing agents (e.g., DTT) if the protein contains critical cysteine residues

    • Monitor pH stability (typically pH 7.5-8.0 is optimal for most recombinant bacterial proteins)

What experimental approaches are most effective for studying Lgt function?

Several complementary experimental approaches have proven effective for investigating Lgt function:

  • Genetic depletion systems:

    • Arabinose-inducible promoter control of lgt expression allows for controlled depletion studies

    • This approach enables analysis of the physiological consequences of varying levels of Lgt depletion

  • Biochemical activity assays:

    • In vitro assays measuring the transfer of diacylglyceryl moiety from phosphatidylglycerol to prolipoprotein substrates

    • Detection methods include radiolabeled lipid substrates or mass spectrometry-based approaches

  • Cell envelope integrity assessment:

    • SYTOX Green permeability assays to evaluate outer membrane integrity

    • Antibiotic sensitivity profiling using agents normally excluded by the outer membrane

  • Complementation studies:

    • Expression of heterologous lgt genes to evaluate functional conservation

    • Introduction of specific mutations to identify critical residues

  • Protein-substrate interaction analysis:

    • Co-immunoprecipitation to identify Lgt-substrate interactions

    • Cross-linking approaches to capture transient enzyme-substrate complexes

How can researchers quantitatively assess Lgt enzymatic activity?

Quantitative assessment of Lgt enzymatic activity can be performed using several approaches:

  • Biochemical assay using purified components:

    • Recombinant Lgt

    • Synthetic prolipoprotein substrate (peptide containing lipobox motif)

    • Phosphatidylglycerol donor

    • Detection of diacylglyceryl transfer via:

      • Radiolabeled phosphatidylglycerol

      • Mass spectrometry to detect modified peptides

      • FRET-based assays using modified substrates

  • Cellular assay monitoring prolipoprotein processing:

    • Western blot analysis to detect accumulation of unprocessed prolipoproteins

    • Mobility shift assays to distinguish between modified and unmodified forms

    • Pulse-chase experiments to track lipoprotein maturation kinetics

  • Enzyme kinetics determination:

    • Measurement of initial reaction rates at varying substrate concentrations

    • Determination of Km and Vmax values for different substrates

    • Evaluation of inhibitor effects through IC50 and Ki determination

What is the relationship between Lgt inhibition and bacterial resistance mechanisms?

The relationship between Lgt inhibition and bacterial resistance mechanisms reveals several important insights:

  • Unique resistance profile:

    • Unlike inhibitors targeting other steps of lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein gene (lpp) is not sufficient to rescue growth after Lgt depletion

    • This suggests Lgt inhibitors may be effective against resistance mechanisms that invalidate inhibitors of downstream steps in lipoprotein biosynthesis

  • Mechanism of lpp-related protection:

    • Counter-intuitively, Lpp appears to be protective against Lgt inhibitors rather than contributing to toxicity

    • Cells expressing the Lpp C21A mutant (with reduced peptidoglycan linkage) show increased sensitivity

  • Experimental data on resistance mechanisms:

    Lipoprotein Pathway TargetEffect of lpp Deletion on Bacterial Survival
    LgtNo rescue/increased sensitivity
    LspAGrowth rescue
    LolCDEGrowth rescue

This distinctive pattern suggests that Lgt represents a particularly promising antibacterial target with reduced susceptibility to common resistance mechanisms .

How do Lgt inhibitors affect bacterial cell physiology?

Lgt inhibitors induce multiple physiological effects that ultimately lead to bacterial cell death:

  • Membrane permeabilization effects:

    • Increased permeability to SYTOX Green dye, indicating outer membrane disruption

    • Enhanced susceptibility to antibiotics normally excluded by the intact outer membrane

  • Changes in lipoprotein processing:

    • Accumulation of unprocessed prolipoprotein forms

    • Altered cellular distribution of lipoprotein intermediates

    • Reduction in peptidoglycan-linked lipoproteins

  • Morphological alterations:

    • Increased cell size

    • Inner membrane contraction effects

    • Disruption of outer membrane-peptidoglycan linkage

  • Functional consequences:

    • Loss of serum resistance in pathogenic strains

    • Bactericidal activity even with partial inhibition (~25% depletion of Lgt)

    • Attenuated virulence in infection models

What are the challenges in developing Lgt-targeted antimicrobials?

Developing effective Lgt-targeted antimicrobials presents several key challenges:

What genetic tools are available for studying Lgt function?

Researchers have several genetic tools available for investigating Lgt function:

  • Inducible expression systems:

    • Arabinose-inducible promoter systems allow tight control of Lgt expression levels

    • Enable precise studies of the effects of varying degrees of Lgt depletion

  • Complementation constructs:

    • Expression vectors containing heterologous lgt genes to assess functional conservation

    • Site-directed mutagenesis to create specific variants for structure-function studies

  • Reporter fusions:

    • Transcriptional fusions to monitor lgt expression under different conditions

    • Translational fusions to track Lgt localization and abundance

  • Gene deletion strategies:

    • Construction of conditional lgt mutants, as complete deletion is typically lethal

    • Complementation with wild-type or mutant alleles to restore function

  • Downstream gene expression analysis:

    • Methods to ensure maintenance of expression of downstream genes (e.g., thyA) when manipulating lgt expression

How can researchers distinguish between direct and indirect effects of Lgt inhibition?

Distinguishing direct from indirect effects of Lgt inhibition requires a multi-faceted experimental approach:

  • Parallel comparison with genetic depletion:

    • Compare phenotypic effects of chemical inhibition with those of genetic depletion

    • Concordance suggests direct, on-target effects of inhibitors

  • Biochemical validation:

    • Demonstrate direct inhibition of purified Lgt enzymatic activity in vitro

    • Establish concentration-dependent effects that correlate with cellular phenotypes

  • Substrate accumulation analysis:

    • Monitor accumulation of Lgt substrates (e.g., pro-Lpp) by Western blot analysis

    • Use SDS fractionation to separate peptidoglycan-associated and non-peptidoglycan-associated proteins

  • Time-course studies:

    • Early effects are more likely to be direct consequences of Lgt inhibition

    • Later effects may represent secondary adaptations or downstream consequences

  • Suppressor analysis:

    • Test if genetic modifications known to suppress consequences of Lgt depletion also suppress inhibitor effects

    • Differential suppression patterns may indicate off-target activities

What are the most reliable biochemical assays for Lgt activity and inhibition?

Several biochemical assays provide reliable assessment of Lgt activity and inhibition:

  • In vitro enzymatic assays:

    • Purified recombinant Lgt protein

    • Synthetic or purified prolipoprotein substrates

    • Phosphatidylglycerol as lipid donor

    • Detection of product formation via:

      • Mass spectrometry

      • SDS-PAGE mobility shift

      • Specialized lipid detection methods

  • Cellular assays for Lgt function:

    • Western blot detection of prolipoprotein processing

    • SDS fractionation to separate peptidoglycan-associated proteins (PAP) and non-PAP fractions

    • Identification of specific Lpp forms (unmodified pro-Lpp, diacylglyceryl-modified pro-Lpp, triacylated mature Lpp)

  • Inhibitor screening approaches:

    • Lgt binding screens to identify potential inhibitors

    • Secondary validation with enzymatic activity assays

    • Tertiary validation with cellular phenotype assessment

  • Quantitative parameters for inhibitor characterization:

    ParameterDescriptionTypical Methods
    IC50Concentration for 50% inhibitionDose-response in enzymatic assays
    MICMinimum inhibitory concentrationBacterial growth inhibition
    Target engagementDirect binding to LgtThermal shift assays, SPR
    Mechanism of actionCompetitive vs. non-competitiveEnzyme kinetics analysis

How does Lgt depletion affect bacterial pathogenesis in vivo?

Lgt depletion has significant effects on bacterial pathogenesis in vivo:

  • Attenuation in infection models:

    • Depletion of Lgt results in significant attenuation in mouse E. coli bacteremic infection models

    • This attenuation correlates with compromised outer membrane integrity

  • Immune clearance mechanisms:

    • Increased susceptibility to complement-mediated killing

    • Enhanced recognition by innate immune components

    • Greater sensitivity to antimicrobial peptides

  • Physiological consequences:

    • Outer membrane permeabilization allows entry of host defense molecules

    • Altered lipoprotein presentation affects interactions with host pattern recognition receptors

    • Compromised bacterial stress responses reduce adaptation to host environments

These findings validate Lgt as a potential antimicrobial target with relevance to in vivo infection scenarios.

What structural insights inform the design of Lgt inhibitors?

Structural insights that inform Lgt inhibitor design include:

  • Active site architecture:

    • Although detailed structural information for Salmonella newport Lgt is limited in the provided materials, research on related Lgt proteins suggests:

      • A conserved binding pocket for phosphatidylglycerol

      • Recognition elements for the lipobox motif of prolipoproteins

  • Inhibitor binding mechanisms:

    • Potential inhibitors may target:

      • The phosphatidylglycerol binding site

      • The prolipoprotein substrate binding site

      • Allosteric sites affecting enzyme conformation

  • Observations from existing inhibitors:

    • Inability to raise on-target resistant mutants suggests inhibitors may bind to highly conserved, functionally essential regions

    • This parallels observations with globomycin and its improved analog G0790, which bind to conserved active sites of related enzymes

  • Structure-activity relationships:

    • Comparative analysis of inhibitor potency across bacterial species provides insights into conserved binding features

    • Cross-species activity suggests binding to highly conserved regions of Lgt

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.