Recombinant Salmonella newport Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Biochemical Parameters

PropertyDetailSource
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
Storage-20°C (short-term); -80°C (long-term) in Tris-based buffer + 50% glycerol
Enzyme ActivityEC 3.4.21.105; intramembrane proteolysis of helix-destabilized TMDs
InhibitorsPeptidyl-chloromethylketones (CMKs) mimic substrate binding

Functional Role in Bacterial Physiology

Substrate Specificity:

  • Targets orphan subunits of respiratory complexes (e.g., hydrogenase-2, formate dehydrogenases) by cleaving their destabilized TMDs .

  • Proline residues in substrate TMDs (e.g., HybA P³⁰⁰) are essential for recognition and cleavage .

Quality Control Mechanism:

  • GlpG initiates proteolysis of unassembled membrane proteins, preventing toxic aggregation .

  • Cleavage licenses subsequent degradation by downstream proteases, particularly under stress conditions .

Biological Implications:

  • In Salmonella, GlpG may contribute to gut persistence by regulating metabolic pathways (e.g., fatty acid β-oxidation) .

  • Structural studies reveal plasticity in the L1 loop, which forms the S4 substrate-binding subsite .

Research Applications and Findings

Experimental Use Cases:

  • Protein Aggregation Studies: GlpG-cleaved substrates (e.g., HybA) are used to model post-proteolytic degradation cascades .

  • Enzyme Kinetics: Assays using recombinant GlpG quantify cleavage rates of synthetic TMD peptides .

Comparative Analysis:

  • Salmonella GlpG shares 30% identity with Providencia stuartii AarA but differs in TMD topology .

  • Unlike E. coli GlpG, Salmonella GlpG lacks polar effects on adjacent genes (e.g., glpR) in metabolic assays .

Technical Considerations for Use

  • Reconstitution: Lyophilized protein requires dissolution in deionized water + glycerol (5–50%) to prevent aggregation .

  • Activity Assays: Optimal activity is observed in detergent-solubilized membranes (e.g., 0.1% DDM) .

Future Directions

  • Therapeutic Potential: Targeting GlpG could disrupt bacterial membrane homeostasis, offering a novel antibiotic strategy.

  • Mechanistic Studies: High-resolution cryo-EM could elucidate conformational changes during substrate processing.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
glpG; SNSL254_A3791; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDIWLADESQAERVRGELARFIENPG DPRYLAASWQSGQTNSGLRYRRFPFLATLRERAGPVTWIVMLACVLVYIAMSLIGDQTVM VWLAWPFDPVLKFEVWRYFTHIFMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITVI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALLWIVAG WFDWFGMSMANGAHIAGLIVGLAMAFVDTLNARKRT
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Salmonella Newport rhomboid protease GlpG and what is its biological significance?

Rhomboid protease GlpG is a membrane-integrated enzyme that hydrolyzes peptide bonds in the transmembrane domains of protein substrates . In Salmonella Newport, which is the third most common Salmonella enterica serotype causing human infections in the United States (representing approximately 8% of reported infections), GlpG plays a critical role in bacterial persistence .

Methodologically, researchers investigating GlpG's biological significance should employ a multi-faceted approach:

  • Comparative genomic analysis between GlpG-expressing and GlpG-knockout strains

  • Phenotypic characterization under various growth conditions

  • Transcriptomic profiling to identify genes affected by GlpG expression

  • In vivo colonization studies using animal models to assess the impact on pathogenicity

Studies have demonstrated that disruption of the glpG gene significantly reduces bacterial survival in the mouse intestinal tract in the presence of intact natural microbiota, highlighting its importance for bacterial persistence .

How can researchers effectively isolate and purify recombinant Salmonella Newport GlpG for structural studies?

The isolation and purification of recombinant GlpG requires specific methodological considerations due to its membrane-embedded nature:

  • Expression system selection:

    • Bacterial expression systems (typically E. coli BL21 strains)

    • Use of specialized vectors containing solubility-enhancing tags (His, MBP, or SUMO)

    • Induction conditions optimization (temperature, IPTG concentration, duration)

  • Membrane protein extraction protocol:

    • Cell lysis via sonication or French press

    • Detergent screening to identify optimal solubilization conditions

    • Detergent concentrations should be maintained above critical micelle concentration

  • Purification strategy:

    • Initial capture via affinity chromatography

    • Size exclusion chromatography for oligomeric state assessment

    • Ion exchange chromatography for final polishing

  • Quality control assessments:

    • SDS-PAGE analysis to confirm purity

    • Circular dichroism to verify secondary structure

    • Activity assays using fluorogenic peptide substrates

Research has shown that GlpG has weak interaction energies in its active site, which may explain the slow proteolysis mediated by this enzyme . This characteristic should be considered when designing activity assays during purification quality control steps.

What experimental approaches are used to study GlpG function in bacterial persistence?

To study GlpG's role in bacterial persistence, researchers employ several complementary approaches:

  • Genetic manipulation techniques:

    • Generation of glpG knockout strains through homologous recombination

    • Complementation studies with wild-type and mutant glpG variants

    • Transposon mutagenesis for high-throughput screening of genetic interactions

  • Growth and survival assays:

    • In vitro growth in minimal media with different carbon sources

    • Growth in mucus as a model for intestinal colonization

    • Competition assays between wild-type and ΔglpG strains

  • In vivo colonization models:

    • Mouse intestinal colonization with intact microbiota

    • Tracking bacterial persistence using luminescent or fluorescent reporter strains

    • Comparative genomics between recovered isolates

Research has demonstrated that mutation of glpG impairs bacterial growth in mucus and on plates containing the long-chain fatty acid oleate as the sole carbon source . Additionally, disruption of glpG significantly reduced bacterial survival in a mouse gut colonization model with unperturbed natural microbiota .

How does GlpG expression relate to antimicrobial resistance profiles in Salmonella Newport?

While direct causation between GlpG expression and antimicrobial resistance hasn't been definitively established, correlative studies suggest potential relationships:

  • Comparative analysis approaches:

    • Phenotypic antimicrobial susceptibility testing of wild-type vs. ΔglpG strains

    • Transcriptomic analysis to identify resistance genes co-regulated with glpG

    • Proteomic profiling to detect changes in membrane composition affecting drug entry

  • Clinical isolate characterization:

    • PFGE (Pulsed-Field Gel Electrophoresis) and automated ribotyping can discriminate multidrug-resistant S. Newport with sensitivity of 98-100% and specificity of 76-89%

    • Screening for glpG expression levels in isolates with different resistance profiles

    • Analysis of glpG sequence variants in resistant vs. susceptible strains

Studies have identified multidrug-resistant Salmonella Newport strains resistant to at least nine antimicrobials, including extended-spectrum cephalosporins . These strains, known as Newport MDR-AmpC isolates, have been rapidly emerging in both animals and humans throughout the United States . While the direct role of GlpG in this resistance hasn't been established, understanding its function in membrane homeostasis could provide insights into novel resistance mechanisms.

What molecular mechanisms underlie GlpG's influence on bacterial metabolism and how does this affect colonization capacity?

GlpG's influence on bacterial metabolism operates through several sophisticated mechanisms:

  • Regulation of glycerol metabolism:

    • Disruption of glpG has polar effects on the downstream gene glpR, which encodes a transcriptional repressor of factors catalyzing glycerol degradation

    • This disruption affects carbon utilization pathways critical for survival in nutrient-limited environments

  • Fatty acid metabolism connections:

    • Research indicates mutation of either glpG or glpR impairs bacterial growth on plates containing oleate (a long-chain fatty acid) as the sole carbon source

    • This suggests GlpG plays a role in fatty acid utilization pathways

  • Methodological approaches to study these connections:

    • Metabolomic profiling comparing wild-type and ΔglpG strains

    • 13C-labeling experiments to trace carbon flux through central metabolic pathways

    • Transcriptional reporter fusions to monitor expression of metabolic genes

    • Chromatin immunoprecipitation to identify GlpR binding sites affected by GlpG

The following table summarizes key phenotypic differences observed between wild-type and GlpG-deficient strains:

PhenotypeWild-typeΔglpGΔglpRReference
Growth in mucusNormalImpairedImpaired
Growth on oleateNormalImpairedImpaired
Intestinal colonizationNormalSignificantly reducedNot significantly affected
Metabolic flexibilityHighReducedReduced

These findings highlight GlpG's critical role in metabolic adaptation required for intestinal colonization, distinct from the effects of GlpR alone.

How can researchers effectively analyze contradictory data regarding GlpG function across different experimental systems?

Analyzing contradictory data regarding GlpG function requires structured methodological approaches:

  • Systematic comparison framework:

    • Document experimental variables (strain backgrounds, growth conditions, assay methods)

    • Standardize key readouts for direct comparison

    • Perform meta-analysis of published datasets

    • Consider statistical approaches like Bayesian analysis to integrate diverse data types

  • Potential sources of experimental variation to examine:

    • In vitro vs. in vivo models (cell culture vs. animal models)

    • Differences in microbiome composition in intestinal models

    • Variations in recombinant protein preparation methods

    • Differences in substrate selection for enzymatic assays

  • Contradiction resolution strategies:

    • Design experiments with multiple internal controls

    • Perform cross-laboratory validation studies

    • Utilize contradiction detection methods that leverage linguistic rules and logical frameworks to identify inconsistencies in reported results

Research demonstrates that GlpG has weak interaction energies in its active site, which may explain variability in experimental outcomes across different systems . Additionally, the finding that glpG but not glpR significantly impacts intestinal colonization while both affect growth on specific carbon sources points to complex, context-dependent functions that may appear contradictory if not properly contextualized .

What are the most effective genetic engineering approaches to study structure-function relationships in Salmonella Newport GlpG?

Advanced structure-function studies of GlpG require sophisticated genetic engineering approaches:

  • Site-directed mutagenesis strategies:

    • Alanine-scanning mutagenesis of the transmembrane domains

    • Mutation of catalytic residues (Ser, His) to investigate enzymatic mechanisms

    • Introduction of cysteine pairs for disulfide crosslinking studies

    • Domain swapping with other rhomboid proteases to identify specificity determinants

  • Reporter fusion systems:

    • Split-GFP complementation to monitor protein-protein interactions

    • Förster resonance energy transfer (FRET) pairs to detect conformational changes

    • Destabilized fluorescent proteins for real-time monitoring of expression

  • Genome editing techniques:

    • CRISPR-Cas9 approach for precise genomic modifications

    • Recombineering for scarless mutations

    • Inducible gene expression systems for temporal control

  • Structural biology integration:

    • Design of constructs optimized for crystallization

    • Introduction of conformational locks for cryo-EM studies

    • NMR-compatible labeling schemes for dynamic studies

Studies indicate that understanding the weak interaction energies in GlpG's active site is crucial for interpreting the effects of mutations . A methodical approach combining structural predictions, molecular dynamics simulations, and experimental validation is essential for meaningful structure-function analysis.

How does GlpG contribute to Salmonella Newport's ability to persist in diverse host environments?

GlpG plays multifaceted roles in enabling Salmonella Newport to persist across diverse host environments:

  • Environmental adaptation mechanisms:

    • Modulation of membrane fluidity through proteolytic processing of membrane proteins

    • Potential involvement in stress response pathways activated during host colonization

    • Contribution to biofilm formation in environmental reservoirs

  • Host-specific research approaches:

    • Comparative colonization studies across multiple animal models

    • Ex vivo survival assays in tissue explants from different hosts

    • Transcriptional profiling of glpG expression under varying host conditions

    • Competition assays with wild-type and ΔglpG strains in mixed infections

  • Contributing factors to persistence:

    • Metabolic adaptation to host-specific nutrient availability

    • Potential evasion of host immune responses

    • Alteration of cell surface properties affecting recognition by immune cells

Research demonstrates that disruption of glpG significantly reduces bacterial survival specifically in the mouse intestinal tract with intact microbiota , suggesting its importance in competitive environments. This aligns with epidemiological data showing Salmonella Newport as a persistent pathogen capable of causing infections through various transmission routes, including environmental sources .

What novel therapeutic strategies could target GlpG function to combat multidrug-resistant Salmonella Newport infections?

Developing therapeutic strategies targeting GlpG requires multidisciplinary approaches:

  • Drug development methodologies:

    • High-throughput screening of chemical libraries against purified GlpG

    • Fragment-based drug discovery targeting the active site

    • Structure-based design of peptidomimetic inhibitors

    • In silico screening followed by experimental validation

  • Therapeutic potential assessment:

    • Evaluation of GlpG inhibitors in cellular infection models

    • Animal model testing for efficacy and toxicity

    • Combination therapy approaches with existing antibiotics

    • Resistance development monitoring during treatment

  • Considerations for antimicrobial development:

    • Specificity for bacterial vs. mammalian rhomboid proteases

    • Bioavailability in intestinal and systemic compartments

    • Potential for resistance development

    • Effects on commensal bacteria expressing rhomboid proteases

The increasing prevalence of multidrug-resistant Salmonella Newport strains, such as the REPJJP01 strain identified by CDC in 2016, which has been found in all 50 states and is resistant to multiple antibiotics including decreased susceptibility to azithromycin , underscores the urgency of developing novel therapeutic approaches. The unique membrane-embedded nature of GlpG presents both challenges and opportunities for drug development strategies aimed at overcoming conventional antibiotic resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.