Recombinant Salmonella newport Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Salmonella Newport Spermidine export protein MdtJ is a membrane-associated transporter responsible for spermidine efflux, a polyamine crucial for bacterial growth and stress adaptation. This protein is produced recombinantly in E. coli systems with a His-tag for purification .

Key Features:

PropertyDetails
SpeciesSalmonella newport (strain SL254)
UniProt IDB4T5B8
Gene NamemdtJ (synonyms: SNSL254_A1592)
Protein LengthFull-length (1-120 amino acids)
Expression SystemE. coli
TagN-terminal His-tag
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose

Amino Acid Sequence:

The protein sequence begins with MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKK... and shares >90% homology across Salmonella serotypes (e.g., S. Agona, S. Dublin) . Key structural motifs include transmembrane domains critical for spermidine binding and export .

Mechanism of Action:

MdtJ functions as part of the MdtJI complex, which couples spermidine efflux with proton antiport to mitigate intracellular polyamine toxicity . This activity is linked to bacterial survival under high spermidine conditions and contributes to multidrug resistance (MDR) phenotypes .

Expression and Purification:

  • Host: E. coli

  • Purity: >90% (SDS-PAGE)

  • Form: Lyophilized powder or glycerol-supplemented liquid

  • Reconstitution: Requires sterile water and glycerol (5–50%) for stability .

Stability Considerations:

  • Avoid repeated freeze-thaw cycles .

  • Working aliquots stored at 4°C retain functionality for ≤1 week .

Genomic Localization:

  • Located in chromosomal regions associated with efflux pump operons (e.g., mdtJI) .

  • Co-expressed with mdtI in E. coli to form a functional transporter complex .

Resistance Gene Associations:

  • Linked to genes conferring resistance to β-lactams (ampH), quinolones (qnrB), and colistin (mcr-1) .

  • Found in MDR Salmonella Newport strains isolated from seafood and livestock .

Antimicrobial Resistance Studies:

  • MdtJ overexpression correlates with reduced susceptibility to tetracycline, sulfonamides, and cephalosporins .

  • Role in colistin resistance highlighted in Chinese clinical isolates carrying mcr-1 .

Vaccine Development:

  • Attenuated Salmonella Newport strains (e.g., CVD 1979) lacking aroA show potential as vaccine candidates, though MdtJ’s role in immunogenicity remains understudied .

Clinical and Environmental Impact:

  • MDR Salmonella Newport strains with mdtJ are prevalent in bovine, poultry, and seafood supply chains, posing zoonotic risks .

  • In the U.S., 8% of Newport isolates (2004–2013) exhibited ACSSuTAuCx resistance patterns linked to efflux systems .

Future Directions

  • Structural studies to resolve MdtJ’s binding sites for spermidine and antibiotics.

  • Inhibition assays targeting MdtJI to reverse antimicrobial resistance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.
Synonyms
mdtJ; SNSL254_A1592; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
mdtJ
Target Protein Sequence
MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Salmonella newport MdtJ protein?

The Salmonella newport MdtJ protein (Uniprot: B4T5B8) is a small membrane protein functioning as a spermidine export protein. The full amino acid sequence is MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAYALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI . Structurally, it contains transmembrane domains consistent with its role as a transport protein. The expression region spans amino acids 1-120, representing the full-length protein . As a membrane protein, MdtJ contains hydrophobic segments that facilitate its integration into the bacterial cell membrane, which is essential for its transport function of extruding spermidine from the bacterial cytoplasm.

What is the genomic context of the mdtJ gene in Salmonella newport?

The mdtJ gene in Salmonella newport strain SL254 is designated by the ordered locus name SNSL254_A1592 . This gene encodes the spermidine export protein MdtJ, which plays a role in polyamine transport. Within the Salmonella genome, transport proteins like MdtJ are critical components of systems that help regulate internal metabolite concentrations and contribute to homeostasis. While specific genomic context data for mdtJ is limited in the provided search results, Salmonella species typically contain multiple transport proteins that function in concert to maintain cellular physiology and respond to environmental stressors.

What are the optimal storage and handling conditions for recombinant MdtJ protein?

For optimal preservation of recombinant Salmonella newport MdtJ protein, storage at -20°C is recommended, with extended storage at -20°C or -80°C for maximum stability . The protein is typically supplied in a Tris-based buffer with 50% glycerol, specifically optimized for this protein . To maintain protein integrity, repeated freezing and thawing should be avoided. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . These storage recommendations help preserve the structural integrity and functional activity of the recombinant protein, which is critical for obtaining reliable experimental results.

What approaches can be used to study MdtJ function in Salmonella newport?

To investigate MdtJ function in Salmonella newport, researchers can employ several complementary approaches:

  • Gene deletion studies: Utilizing scarless deletion protocols similar to those developed for methyl-accepting chemotaxis genes in Salmonella . This approach enables precise genomic manipulation without introducing antibiotic resistance markers or unintended mutations.

  • Recombinant expression systems: Expressing the protein with tags for purification and functional characterization .

  • Transport assays: Measuring spermidine transport across membranes in wild-type versus mdtJ-deleted strains.

  • Structural biology approaches: Utilizing crystallography or cryo-EM to determine the three-dimensional structure of MdtJ.

  • Genomic complementation: Reintroducing functional mdtJ into deletion mutants to confirm phenotypic restoration, similar to methods used in other Salmonella studies .

These methodologies can be combined to comprehensively characterize MdtJ function, regulation, and its role in Salmonella physiology and pathogenesis.

How can researchers effectively express and purify recombinant MdtJ for functional studies?

For effective expression and purification of recombinant MdtJ protein:

  • Expression system selection: As MdtJ is a membrane protein, specialized expression systems like E. coli strains designed for membrane protein expression (C41, C43) are recommended.

  • Vector design: Incorporate appropriate tags (His, FLAG, or GST) to facilitate purification while considering that tag placement may affect protein function.

  • Membrane extraction: Use mild detergents (DDM, LDAO, or CHAPS) to solubilize MdtJ from membranes without denaturing the protein.

  • Purification strategy: Implement a two-step purification approach combining affinity chromatography followed by size exclusion chromatography.

  • Quality control: Assess protein purity by SDS-PAGE and Western blotting, and structural integrity by circular dichroism spectroscopy.

When working with membrane proteins like MdtJ, maintaining the native conformation is critical, which often requires optimization of detergent conditions throughout the purification process to preserve functional activity for downstream studies.

What methods are available for analyzing mdtJ gene expression in different environmental conditions?

Several complementary methods can be employed to analyze mdtJ gene expression under varying environmental conditions:

  • Quantitative RT-PCR: Measures mdtJ mRNA levels with high sensitivity, allowing for precise quantification of expression changes in response to environmental stimuli.

  • RNA-Seq: Provides comprehensive transcriptomic profiling to identify co-regulated genes and regulatory networks involving mdtJ.

  • Reporter gene fusions: Constructing mdtJ-luciferase or mdtJ-GFP fusions enables real-time monitoring of expression in living cells.

  • Chromatin immunoprecipitation (ChIP): Identifies transcription factors that bind to the mdtJ promoter region.

  • Proteomics: Quantifies MdtJ protein levels using mass spectrometry to correlate transcriptional changes with protein abundance.

These methods can be applied to investigate mdtJ expression under conditions relevant to Salmonella infection cycles, such as acid stress, nutrient limitation, or exposure to host defense molecules, providing insights into the environmental regulation of this spermidine export protein.

What is the role of MdtJ in antibiotic resistance mechanisms of Salmonella newport?

The potential role of MdtJ in antibiotic resistance of Salmonella newport warrants investigation through several research approaches:

  • Minimum inhibitory concentration (MIC) testing: Comparing antibiotic susceptibility profiles between wild-type and mdtJ knockout strains across different antibiotic classes.

  • Efflux pump inhibitor studies: Determining whether MdtJ function is affected by known efflux pump inhibitors, which would suggest a role in antibiotic export.

  • Radioactive or fluorescent-labeled antibiotic transport assays: Directly measuring whether MdtJ can transport antibiotics across the membrane.

  • Promoter analysis: Investigating whether mdtJ expression is upregulated in response to antibiotic exposure.

  • Structural modeling: Examining binding pocket similarities between MdtJ and known antibiotic efflux transporters.

As multidrug resistance is a growing concern with Salmonella infections , understanding whether spermidine transporters like MdtJ contribute to antibiotic resistance mechanisms could provide new targets for adjuvant therapies to enhance antibiotic efficacy.

How do polyamine transport systems, including MdtJ, interact with host defense mechanisms?

Polyamine transport systems, including MdtJ, may interact with host defense mechanisms in several ways that can be investigated using these approaches:

  • Intracellular survival assays: Comparing survival of wild-type versus mdtJ mutant Salmonella within macrophages or dendritic cells to assess resistance to host killing mechanisms.

  • Reactive oxygen/nitrogen species (ROS/RNS) challenge experiments: Testing whether MdtJ contributes to bacterial survival under oxidative or nitrosative stress mimicking host immune responses.

  • Polyamine competition assays: Determining if host-derived polyamines influence bacterial MdtJ function.

  • Transcriptional response analysis: Identifying gene expression changes in host cells infected with wild-type versus mdtJ mutant Salmonella.

  • Immunological profiling: Measuring cytokine production and immune cell recruitment in response to infection with wild-type versus mdtJ mutant strains.

Understanding these interactions could reveal how Salmonella exploits polyamine transport to subvert host defenses, potentially leading to new therapeutic approaches targeting these systems.

What are the key considerations when designing gene deletion experiments for mdtJ in Salmonella newport?

When designing gene deletion experiments for mdtJ in Salmonella newport, researchers should consider:

  • Deletion strategy selection: Implementing scarless deletion protocols like those described for methyl-accepting chemotaxis genes , which utilize λ Red recombinase-mediated integration followed by I-SceI-induced double-strand breaks to select for markerless mutants.

  • Confirmation methods: Validating deletions through PCR, sequencing, and whole genome sequencing to ensure precise genomic modifications without off-target effects .

  • Complementation controls: Creating complementation strains expressing functional mdtJ from plasmids or chromosomal insertions to verify phenotype restoration.

  • Polar effects assessment: Evaluating whether mdtJ deletion affects expression of neighboring genes, particularly if mdtJ is part of an operon.

  • Strain background considerations: Recognizing that different Salmonella newport strains may exhibit variable phenotypes following mdtJ deletion due to genetic background differences.

This methodological approach ensures that observed phenotypes can be confidently attributed to the specific absence of mdtJ rather than unintended genomic alterations.

How can researchers address membrane protein solubility challenges when working with recombinant MdtJ?

Addressing membrane protein solubility challenges with recombinant MdtJ requires a systematic approach:

  • Detergent screening matrix:

Detergent ClassExamplesOptimal Concentration RangeApplications
Mild Non-ionicDDM, DMNG0.01-0.1%Initial extraction
ZwitterionicLDAO, CHAPS0.05-0.5%Intermediate purification
AmphipolsA8-35, PMAL-C81:3 protein:amphipol ratioStructural studies
NanodiscsMSP1D1, MSP1E3D1Dependent on target sizeFunctional assays
  • Fusion partner strategies: Incorporating solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO at the N-terminus can improve expression and folding.

  • Expression temperature optimization: Lowering expression temperature to 16-20°C slows protein synthesis, potentially improving membrane insertion and folding.

  • Co-expression with chaperones: Introducing molecular chaperones like GroEL/GroES can enhance proper folding of membrane proteins.

  • Lipid supplementation: Adding specific phospholipids during purification can stabilize the native conformation of membrane proteins like MdtJ.

These strategies can be applied sequentially or in combination to optimize recombinant MdtJ solubility, purification yield, and functional activity for downstream structural and functional studies.

What are the technical challenges in measuring spermidine transport activity of MdtJ?

Measuring spermidine transport activity of MdtJ presents several technical challenges that can be addressed through specialized methodologies:

  • Reconstitution systems: Establishing proteoliposomes or nanodiscs containing purified MdtJ in defined lipid environments to create controlled transport systems.

  • Transport substrate considerations: Utilizing radiolabeled (³H or ¹⁴C) or fluorescently labeled spermidine derivatives to track transport with high sensitivity.

  • Counterflow assays: Preloading liposomes with unlabeled substrate and measuring influx of labeled substrate to demonstrate MdtJ-mediated exchange.

  • Electrical measurements: Employing solid-supported membrane electrophysiology to detect charge movements associated with spermidine transport.

  • Competition assays: Identifying transport inhibitors and substrate specificity by comparing transport rates in the presence of structural analogs or potential inhibitors.

These approaches collectively provide multiple lines of evidence for MdtJ-mediated spermidine transport and can reveal mechanistic details about transport kinetics, energetics, and regulation that are essential for understanding MdtJ's physiological role.

How can structural biology approaches advance our understanding of MdtJ function?

Structural biology approaches offer powerful tools to elucidate MdtJ function:

  • Cryo-electron microscopy: Enabling visualization of MdtJ in different conformational states (inward-facing, outward-facing, occluded) to understand the transport mechanism.

  • X-ray crystallography: Providing high-resolution structures if diffraction-quality crystals can be obtained, potentially revealing substrate binding sites.

  • NMR spectroscopy: Offering insights into dynamics and conformational changes during the transport cycle, particularly for specific domains or segments.

  • Molecular dynamics simulations: Modeling interactions between MdtJ, membrane lipids, and spermidine to predict transport pathways and energetics.

  • Cross-linking mass spectrometry: Identifying key residues involved in substrate binding or conformational changes during transport.

These structural insights would significantly advance our understanding of polyamine transport mechanisms in bacteria and could guide rational design of inhibitors targeting MdtJ as potential antibacterial agents.

What potential exists for targeting MdtJ in novel antimicrobial development strategies?

The potential for targeting MdtJ in antimicrobial development can be explored through several research avenues:

  • High-throughput screening: Developing assays to identify small molecule inhibitors of MdtJ-mediated spermidine transport.

  • Structure-based drug design: Utilizing structural data to design compounds that specifically bind to and inhibit MdtJ function.

  • Combination therapy approaches: Testing whether MdtJ inhibitors sensitize Salmonella to existing antibiotics, particularly in the context of multidrug-resistant strains .

  • Polyamine transport inhibitor development: Creating spermidine analogs that competitively inhibit transport or irreversibly bind to the transporter.

  • Vaccine development: Evaluating whether MdtJ or peptides derived from it could serve as antigens in vaccine formulations, similar to approaches used with other Salmonella proteins .

As antibiotic resistance continues to emerge in Salmonella , novel targets like MdtJ represent important opportunities for developing alternative therapeutic strategies that could circumvent existing resistance mechanisms.

How does MdtJ interact with other components of polyamine homeostasis systems in Salmonella?

Understanding MdtJ's interactions within the broader polyamine homeostasis network requires comprehensive investigation:

  • Interactome analysis: Using pull-down assays coupled with mass spectrometry to identify proteins that directly interact with MdtJ.

  • Synthetic lethality screening: Identifying genes whose deletion is lethal when combined with mdtJ deletion, indicating functional relationships.

  • Transcriptional network mapping: Performing RNA-Seq on wild-type and mdtJ mutant strains to identify genes with altered expression, revealing regulatory connections.

  • Metabolic flux analysis: Measuring changes in polyamine synthesis, utilization, and export pathways when mdtJ is deleted or overexpressed.

  • Polyamine stress response studies: Investigating how MdtJ contributes to bacterial adaptation to polyamine excess or limitation.

Such studies would place MdtJ within the context of the complete polyamine transport and metabolism network, providing insights into how these systems collectively contribute to Salmonella physiology and pathogenesis.

What are the most promising research directions for understanding MdtJ in Salmonella pathogenesis?

The most promising research directions for understanding MdtJ's role in Salmonella pathogenesis include:

  • Host-pathogen interaction studies: Investigating how MdtJ-mediated polyamine transport influences Salmonella survival within host cells and tissues.

  • Systems biology approaches: Integrating transcriptomics, proteomics, and metabolomics data to position MdtJ within infection-relevant regulatory networks.

  • In vivo infection models: Utilizing animal models to assess the contribution of MdtJ to colonization, persistence, and virulence.

  • Biofilm regulation studies: Exploring whether MdtJ influences biofilm formation, which is a critical virulence determinant in Salmonella .

  • Comparative analysis across serovars: Examining functional conservation and divergence of MdtJ across different Salmonella serovars to identify correlations with host range or virulence.

These research directions collectively address the fundamental question of how polyamine transport contributes to Salmonella's success as a pathogen and may reveal new intervention strategies for controlling Salmonella infections.

How might advances in synthetic biology facilitate MdtJ research?

Advances in synthetic biology offer powerful new approaches to MdtJ research:

  • CRISPR-Cas9 genome editing: Enabling precise manipulation of mdtJ and related genes with increased efficiency compared to traditional methods .

  • Biosensors: Developing polyamine-responsive genetic circuits that provide real-time readouts of intracellular polyamine levels for studying MdtJ function.

  • Promoter engineering: Creating synthetic, tunable promoters for controlled expression of mdtJ to study dosage effects.

  • Protein engineering: Designing MdtJ variants with altered substrate specificity or transport kinetics to probe structure-function relationships.

  • Minimal cell systems: Reconstituting MdtJ in simplified cellular systems to study its function in isolation from other transport systems.

These synthetic biology approaches provide unprecedented control over experimental systems, allowing researchers to dissect MdtJ function with greater precision and potentially accelerating discoveries about its role in Salmonella physiology and pathogenesis.

What collaborative research frameworks would accelerate knowledge development about MdtJ and related transporters?

Accelerating knowledge development about MdtJ requires collaborative frameworks that integrate diverse expertise:

  • Interdisciplinary research consortia: Bringing together microbiologists, structural biologists, computational biologists, and clinicians to address complementary aspects of MdtJ biology.

  • Standardized methodological platforms: Establishing shared protocols for protein expression, purification, and functional assays to enable cross-laboratory validation.

  • Comparative studies across bacterial species: Investigating functional conservation of MdtJ homologs across diverse bacterial pathogens to identify universal and species-specific features.

  • Data sharing initiatives: Creating centralized repositories for structural, functional, and genomic data related to polyamine transporters.

  • Translational research partnerships: Connecting basic science discoveries about MdtJ to clinical and industrial applications through academic-industry collaborations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.