ArnC plays a crucial role in bacterial resistance to polymyxins, which are last-resort antimicrobial peptides used against multi-drug resistant bacteria . The arnBCADTEF operon encodes a series of enzymes that modify lipid A by adding a 4-amino-4-deoxy-L-arabinose (L-Ara4N) headgroup . This modification reduces the effectiveness of polymyxins . Prior to the transfer of Ara4N to undecaprenyl-phosphate by ArnT, ArnC N-formylates Ara4N . The product of this reaction, undecaprenyl-phospho-4-deoxy-4-formamido-L-arabinose (C55P-Ara4FN), requires further processing by the deformylase ArnD to generate the final C55P-Ara4N donor .
ArnC is classified as a type-2 glycosyltransferase (GT-2) localized to the inner membrane . Cryo-EM structures of Salmonella typhimurium ArnC have revealed key structural features :
Protomer Structure The ArnC protomer consists of three regions: an N-terminal glycosyltransferase domain, a transmembrane region, and interface helices (IHs) . The N-terminal region folds into a Rossman-like $$ \alpha $$-$$ \beta $$ domain, similar to the GT-A domain found in GT-2 glycosyltransferases . Interface helices IH1 and IH2 are positioned along the membrane plane, and the C-terminal portion contains two transmembrane (TM) helices, TM1 and TM2 .
Tetramer Formation ArnC forms a stable tetramer with C2 symmetry through interactions in the C-terminal region . The C-terminal $$ \beta $$8 strand inserts into the adjacent protomer, stabilizing the tetrameric state through hydrogen bonds and salt bridges .
UDP Binding The binding of UDP induces conformational changes that stabilize the A-loop (residues 201-213) and part of the catalytic pocket formed by IH1 and IH2 .
Salmonella utilizes various metabolic pathways to thrive within its host . While ArnC is not directly involved in core metabolic processes like the utilization of fructose-asparagine (F-Asn), its role in modifying LPS impacts the bacterium's ability to resist host defenses and antimicrobial agents . Enzymes like FraB deglycase are essential for Salmonella to utilize specific nutrients during inflammation .
Recent studies have provided structural insights into ArnC and its mechanism of action :
Cryo-EM structures of ArnC in both apo and UDP-bound forms have been determined at 2.75 Å and 3.8 Å resolutions, respectively .
These structures reveal the three main structural elements of the ArnC protomer and define the mechanism of its tetrameric arrangement .
Comparative analysis with homologous proteins like GtrB and DPMS suggests key residues involved in ArnC catalytic activity .
Deletion of the arnC gene in polymyxin-resistant E. coli decreases the level of UndP-Ara4FN, confirming its role in the formation of UndP-Ara4FN .
Understanding the structure and function of ArnC is crucial for developing new strategies to combat polymyxin resistance in Gram-negative pathogens . By targeting ArnC, it may be possible to disrupt the lipid A modification pathway and restore the effectiveness of polymyxins .
This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, playing a critical role in conferring resistance to polymyxins and cationic antimicrobial peptides.
KEGG: see:SNSL254_A2483
Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) is an enzyme (EC 2.7.8.30) encoded by the arnC gene in Salmonella newport. This enzyme facilitates the transfer of 4-deoxy-4-formamido-L-arabinose to undecaprenyl-phosphate, which is a critical step in cell wall modification processes. The arnC enzyme belongs to a family of transferases that play essential roles in the biosynthesis and modification of bacterial cell envelope components. In Salmonella newport strain SL254, the protein is identified by UniProt accession number B4SYX0 and functions within pathways that can affect bacterial survival and virulence .
The arnC protein from Salmonella newport (strain SL254) consists of 327 amino acids in its full-length form. Its primary sequence begins with MFDAAPIKKVSVVIPVYNEQESLPELIRRTTTACESLGKAWEILLIDDGSSDSSAELMVK and continues as documented in the UniProt database (B4SYX0). The protein contains distinctive functional domains characteristic of transferase enzymes, including substrate binding regions and catalytic sites. The three-dimensional structure involves both hydrophilic regions that interact with cytoplasmic components and hydrophobic domains that facilitate membrane integration, as suggested by the presence of transmembrane segments in its sequence .
The arnC gene plays a significant role in modifying Salmonella newport's cell surface properties through its enzymatic product. These modifications can influence the bacterium's interaction with host defense mechanisms and antimicrobial agents. While not directly identified in the provided search results as a specific virulence determinant, the arnC gene likely contributes to Salmonella newport's distinctive phenotypic characteristics, including potential contributions to antimicrobial resistance mechanisms. The gene is particularly important when considering Salmonella newport's capacity to survive in diverse environments, including within plant tissues, where cell surface modifications may provide competitive advantages .
For optimal expression of recombinant Salmonella newport arnC protein, researchers should consider several key parameters. Expression systems utilizing E. coli BL21(DE3) or similar strains have shown good results for related bacterial transferases. Induction conditions typically involve IPTG at concentrations between 0.1-1.0 mM, with expression temperatures of 16-30°C to balance yield and solubility. The addition of membrane-stabilizing agents or detergents may improve recovery of functional protein due to arnC's membrane-associated nature. Post-expression handling requires gentle cell disruption methods and careful purification strategies, potentially including immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to maintain enzyme activity .
The most effective purification strategies for isolating active arnC transferase involve a multi-step approach designed to maintain protein stability and functionality. Initially, affinity chromatography using histidine or other fusion tags can provide good primary separation. This should be followed by ion exchange chromatography to remove contaminants while maintaining the protein in a buffer system that preserves its native conformation. For final purification, size exclusion chromatography can separate oligomeric states and remove aggregates. Throughout the process, it's critical to maintain a stabilizing buffer containing appropriate salt concentrations (typically 150-300 mM NaCl), pH (generally 7.0-8.0), and potentially glycerol (20-50%) as indicated in the storage recommendations for commercial preparations .
For assessing arnC enzymatic activity, researchers should employ a combination of direct and indirect analytical methods. Direct measurement of enzyme kinetics can be performed using radiolabeled or fluorescently-tagged substrate analogs to track the transfer of 4-deoxy-4-formamido-L-arabinose to undecaprenyl-phosphate. High-performance liquid chromatography (HPLC) or thin-layer chromatography (TLC) can separate and quantify reaction products. Mass spectrometry approaches, particularly LC-MS/MS, provide detailed analysis of reaction products and intermediates. Indirect methods include monitoring changes in bacterial susceptibility to antimicrobial compounds that target cell envelope structures when arnC is active versus when it is inhibited or deleted. Complementation assays in arnC-deficient strains can also provide functional verification of enzyme activity .
The arnC enzyme likely contributes to antimicrobial resistance in Salmonella newport through its role in modifying cell envelope components. By transferring 4-deoxy-4-formamido-L-arabinose to lipopolysaccharide structures, arnC may alter the bacterial surface charge and permeability, potentially reducing the binding and penetration of cationic antimicrobial peptides and certain antibiotics. This mechanism aligns with observations of multidrug-resistant Salmonella newport strains (MDR-AmpC) that exhibit resistance to multiple antimicrobial agents. While the specific contribution of arnC to the MDR-AmpC phenotype is not directly established in the search results, its function in cell envelope modification suggests it could be part of the complex resistance mechanisms that make Salmonella newport a significant public health concern .
Mutations in the arnC gene would likely alter Salmonella newport's antimicrobial susceptibility profile through changes in cell envelope modification capabilities. Loss-of-function mutations could potentially increase susceptibility to cationic antimicrobial peptides and certain antibiotics that target cell envelope structures or require specific surface interactions for activity. Conversely, gain-of-function mutations or upregulation of arnC expression might enhance resistance mechanisms by increasing cell surface modifications. While the search results don't provide direct experimental evidence of specific arnC mutations and their effects, the enzyme's role suggests that genetic variations affecting its function would impact the bacterium's interaction with antimicrobial agents. This represents an important area for further research, particularly in the context of evolving resistance mechanisms in Salmonella newport .
The arnC enzyme may contribute significantly to Salmonella newport's remarkable ability to colonize plant tissues, particularly tomatoes and other vegetables. By modifying cell surface components, arnC could enhance bacterial adaptation to plant environments through altered surface charge, hydrophobicity, or other physical properties that facilitate attachment to plant surfaces and survival within plant tissues. Salmonella newport has been identified as the predominant serovar in vegetable-associated outbreaks, responsible for 57% of outbreaks linked to fresh vegetables and 29% of those associated with vine-stalk vegetables. This overrepresentation suggests specialized adaptations for plant colonization, potentially including arnC-mediated cell envelope modifications that provide competitive advantages in these environments .
The comparison of arnC function between Salmonella newport strains from different sources may reveal important adaptive variations. Strains isolated from plants, particularly those repeatedly associated with tomato outbreaks, might exhibit distinctive arnC variants or expression patterns compared to strains from animal sources. These differences could reflect adaptation to specific environmental niches. Research has shown that Salmonella newport outcompetes other serovars during plant colonization, reaching higher cell numbers in tomatoes than serovars Typhimurium, Braenderup, and Montevideo. While the search results don't directly compare arnC function between plant and animal isolates, the observation that some Newport strains exhibit non-rdar mutations that increase fitness within tomatoes suggests potential variations in cell surface modification mechanisms that might involve arnC .
The role of arnC in Salmonella newport's virulence likely involves modulating host-pathogen interactions through cell surface modifications. By altering lipopolysaccharide structures, arnC may affect recognition by host immune receptors, resistance to antimicrobial peptides, and survival within host cells. Salmonella newport has demonstrated the ability to cause severe infections in both humans and animals, with particular concern for MDR-AmpC strains that have been associated with treatment failures and deaths. The search results indicate that Salmonella newport infections can progress from self-limiting diarrhea to life-threatening systemic infections requiring effective antimicrobial therapy. While the specific contribution of arnC to this virulence is not directly established in the provided information, its function suggests potential roles in pathogenesis and host adaptation .
For studying arnC protein-protein interactions in Salmonella newport, researchers can employ multiple complementary approaches. Bacterial two-hybrid systems can identify potential interaction partners in vivo. For in vitro analysis, pull-down assays using recombinant tagged arnC can isolate protein complexes for identification by mass spectrometry. Cross-linking coupled with mass spectrometry (XL-MS) can capture transient interactions and provide spatial information about interaction interfaces. Isothermal titration calorimetry (ITC) and surface plasmon resonance (SPR) offer quantitative measurements of binding affinities and kinetics. Advanced microscopy techniques including super-resolution approaches can visualize interactions in cellular contexts. Computational predictions can guide these experimental approaches, while comparative analyses across Salmonella serovars might reveal conserved or unique interaction patterns .
Structural biology approaches offer powerful tools for understanding arnC substrate specificity. X-ray crystallography of arnC in complex with substrate analogs or inhibitors can reveal atomic-level details of binding interactions. Cryogenic electron microscopy (cryo-EM) may be particularly valuable if arnC functions within a larger membrane-associated complex. Nuclear magnetic resonance (NMR) spectroscopy can provide insights into protein dynamics relevant to substrate recognition. Computational approaches including molecular docking and molecular dynamics simulations can model substrate binding and predict effects of mutations on specificity. Site-directed mutagenesis guided by structural information can experimentally validate key residues involved in substrate recognition and catalysis. Together, these approaches can elucidate the molecular basis for arnC's ability to recognize and process its specific substrates .
The development of arnC inhibitors represents a promising approach for controlling Salmonella newport infections, particularly those caused by multidrug-resistant strains. By targeting this cell envelope modification enzyme, inhibitors could potentially increase bacterial susceptibility to host defense mechanisms and conventional antibiotics. This strategy might be particularly valuable against serotype Newport MDR-AmpC strains that show resistance to multiple antimicrobial agents including extended-spectrum cephalosporins. Furthermore, arnC inhibitors could potentially reduce Salmonella newport's fitness in plant environments, potentially limiting contamination of fresh produce that has been implicated in numerous outbreaks. The design of such inhibitors would require detailed understanding of the enzyme's structure, catalytic mechanism, and role in pathogenesis, highlighting the importance of basic research on this transferase .
Several experimental systems can be employed to study arnC gene regulation in Salmonella newport. Reporter gene fusions (using luciferase, GFP, or β-galactosidase) linked to the arnC promoter can monitor transcriptional activity under various conditions. RNA-seq and quantitative RT-PCR provide direct measurement of arnC transcript levels. Chromatin immunoprecipitation (ChIP) techniques can identify transcription factors and other regulatory proteins that interact with the arnC promoter region. CRISPR interference (CRISPRi) approaches allow for targeted repression to study functional consequences. For post-transcriptional regulation, ribosome profiling can assess translational efficiency. Environmental stimuli relevant to Salmonella newport's lifecycle, including plant-associated conditions, antimicrobial exposures, and host-mimicking environments, should be tested to understand context-dependent regulation that may explain its success in diverse niches .
The arnC enzyme likely plays a significant role in the ecological adaptation of Salmonella newport across diverse environments, from animal hosts to plant surfaces and tissues. By modifying cell envelope structures, arnC could confer adaptability to varying conditions through altered surface properties, potentially including changes in hydrophobicity, charge, and interaction with environmental compounds. This adaptability may partially explain Salmonella newport's success as a pathogen in multiple contexts. The search results highlight that this serovar has been disproportionately associated with vegetable-related outbreaks, particularly tomatoes, suggesting specialized adaptations for plant colonization. Experimental evidence shows that Salmonella newport outcompetes other serovars in tomato colonization and rhizosphere persistence, which may involve arnC-mediated surface modifications that enhance fitness in these specific ecological niches .
Producing high-yield recombinant Salmonella newport arnC protein presents several challenges that require specific solutions. The membrane-associated nature of this transferase often leads to aggregation and inclusion body formation during heterologous expression. This can be addressed by employing specialized expression systems like C41/C43(DE3) E. coli strains designed for membrane proteins or cell-free expression systems. Fusion tags that enhance solubility (such as MBP, SUMO, or TrxA) can improve yields of properly folded protein. Expression at reduced temperatures (16-20°C) with gradual induction strategies helps limit aggregation. Inclusion of appropriate detergents or lipid environments during purification maintains native-like conformations. For large-scale production, optimization of growth media composition and induction conditions through design of experiments (DoE) approaches can significantly improve yields while maintaining enzymatic activity .
The in vitro assay systems that best represent native arnC transferase activity should recreate key aspects of its cellular environment and substrate presentation. Reconstituted membrane systems using nanodiscs or liposomes provide lipid environments that better mimic the natural context of this membrane-associated enzyme. Assays incorporating native or synthetic undecaprenyl-phosphate embedded in these membrane structures, along with purified or synthesized 4-deoxy-4-formamido-L-arabinose donors, allow direct measurement of transferase activity. Detection methods can include radiolabeled substrates, fluorescence-based approaches, or mass spectrometry to quantify reaction products. Comparison of kinetic parameters between different assay formats helps validate physiological relevance. Importantly, pH, ionic strength, and divalent cation concentrations should be optimized to match bacterial periplasmic conditions where this enzymatic activity naturally occurs .
Several bioinformatic tools are particularly valuable for analyzing arnC sequence-structure-function relationships. For primary sequence analysis, tools like BLAST, HMMER, and ClustalOmega can identify homologs and conserved domains across bacterial species. Structural prediction platforms including AlphaFold2 and RoseTTAFold can generate reliable protein structure models even without experimental templates. For functional analysis, tools like InterProScan and Pfam help identify functional domains, while ConSurf can map evolutionary conservation onto structural models to highlight functionally important regions. Molecular docking software such as AutoDock and molecular dynamics simulation packages like GROMACS allow investigation of substrate interactions and conformational dynamics. Integrative approaches combining these tools with experimental data visualization through platforms like PyMOL or ChimeraX provide comprehensive insights into the molecular basis of arnC function .
Developing selective inhibitors of Salmonella newport arnC requires strategic approaches targeting its unique structural and functional properties. Structure-based drug design utilizing computational docking and virtual screening against the enzyme's active site can identify initial hit compounds. Fragment-based drug discovery, where small molecular fragments are identified and then expanded or linked, offers an alternative starting point. Natural product screening, particularly from sources that naturally inhibit bacterial growth, may yield novel scaffold structures. Transition-state analog design based on the arnC catalytic mechanism could produce potent inhibitors. Allosteric inhibitors targeting regulatory sites rather than the active site might offer greater selectivity between bacterial and host enzymes. Validation should include enzymatic assays followed by whole-cell testing to confirm target engagement and antimicrobial activity against Salmonella newport, with particular attention to effects on MDR-AmpC strains .
CRISPR-Cas9 genome editing offers powerful approaches to study arnC function in Salmonella newport through precise genetic modifications. Complete gene knockout can establish baseline phenotypes related to antimicrobial susceptibility, virulence, and plant colonization capability. Point mutations in catalytic residues can create hypomorphic alleles with reduced function for dose-response studies. Domain swapping with homologous genes from other bacterial species can identify regions responsible for substrate specificity or regulatory responses. Promoter modifications allow manipulation of expression levels to understand dosage effects. Fluorescent protein fusions enable tracking of protein localization and expression dynamics. Multiplexed editing targeting arnC alongside related genes can uncover functional redundancy or synergistic interactions within pathways. These approaches can be applied across diverse Salmonella newport strains to understand strain-specific variations in arnC function related to host range or environmental adaptation .
Several critical research questions remain unanswered regarding arnC's role in Salmonella newport's distinctive epidemiological pattern, particularly its association with vegetable-related outbreaks. First, does arnC expression or enzyme activity differ between plant-associated and animal-associated strains, potentially explaining Newport's success in plant environments? Second, how does arnC function contribute to survival on specific plant surfaces or tissues, particularly tomatoes where Newport shows competitive advantages? Third, what environmental signals regulate arnC expression during plant colonization versus animal host infection? Fourth, do specific arnC variants correlate with outbreak potential or virulence in humans? Fifth, how does arnC activity interact with other factors like non-rdar mutations that enhance fitness in tomatoes? Finally, could targeting arnC function provide novel approaches to reduce Salmonella newport contamination in agricultural settings? These questions represent important directions for future research to understand and control this significant foodborne pathogen .