Recombinant Salmonella newport UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
yqhA; SNSL254_A3407; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
yqhA
Target Protein Sequence
MERFLENVMYASRWLLAPVYFGLSLALIALALKFFQEILHVLPNVFALAEADLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISAGKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the predicted structural features and membrane topology of YqhA?

Based on sequence analysis, YqhA is predicted to be a transmembrane protein with the following characteristics:

  • Transmembrane domains: The sequence contains hydrophobic regions consistent with multiple membrane-spanning segments, as expected for a transmembrane protein .

  • Secondary structure prediction: The protein likely contains α-helical transmembrane segments, as indicated by the presence of hydrophobic amino acid stretches (e.g., "VYFGLSLALIALALKF") .

  • Topology: While not explicitly detailed in available research, the YqhA protein structure likely includes N-terminal and C-terminal domains connected by transmembrane helices.

  • Conserved regions: The high sequence conservation between different bacterial species suggests structurally important domains that maintain similar folding patterns across Enterobacteriaceae .

What expression systems and purification methods are recommended for recombinant YqhA production?

Several expression systems can be employed for recombinant YqhA production, each with specific advantages:

  • E. coli expression system: Most commonly used due to high yields and shorter turnaround times. Particularly suitable for initial structural studies .

  • Yeast expression system: Offers good yields and some post-translational modifications .

  • Insect cells with baculovirus: Provides many post-translational modifications necessary for correct protein folding .

  • Mammalian cells: May better retain protein activity through appropriate post-translational modifications .

Purification and handling recommendations:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Storage temperature: -20°C for regular storage; -80°C for extended storage .

  • Working aliquots: Store at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity .

  • For reconstitution of lyophilized protein: Reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add 5-50% glycerol for long-term storage .

What methods are most effective for studying the function of transmembrane proteins like YqhA?

For functional characterization of transmembrane proteins like YqhA, researchers should consider these methodologies:

  • Gene knockout studies: Creating deletion mutants (ΔyqhA) to assess phenotypic changes. This approach can be implemented using:

    • Homologous recombination with antibiotic resistance markers

    • CRISPR-Cas9 gene editing systems

    • Suicide vectors like pDS132 with counterselection markers (sacB)

  • Protein-protein interaction studies:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with detergent solubilization

    • Crosslinking studies followed by mass spectrometry

  • Localization studies:

    • Immunohistochemistry with anti-YqhA antibodies

    • Fluorescent protein fusions (if terminal tags don't disrupt function)

    • Subcellular fractionation followed by Western blotting

  • Structural analysis:

    • Circular dichroism for secondary structure assessment

    • NMR spectroscopy for detailed structural information

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

  • Functional assays:

    • Colonization and persistence assays in relevant host models

    • Membrane permeability assays

    • Transport assays if YqhA is suspected to function as a transporter

How can researchers assess YqhA's role in bacterial colonization and persistence?

To investigate YqhA's potential role in colonization and persistence, researchers should consider these methodological approaches:

  • Competitive index assays:

    • Create isogenic yqhA mutants and wild-type strains with different markers

    • Co-inoculate into relevant models (plant or animal hosts)

    • Calculate competitive index (CI) as ratio of mutant/wild-type recovery

  • Transcriptional analysis:

    • RNA-seq to determine expression patterns of yqhA under different conditions

    • qRT-PCR to quantify expression changes during infection

    • Promoter-reporter fusions to monitor in vivo expression

  • Transposon-insertion sequencing (Tn-Seq):

    • Genome-wide screening to identify genes required for colonization

    • Compare relative abundance of transposon insertions before and after host passage

    • Analyze whether yqhA disruption affects fitness in specific niches

  • Host models:

    • Plant models: Tomato pericarps or other relevant plant tissues

    • Animal models: When studying Salmonella virulence

    • Tissue culture systems: Epithelial cell adherence and invasion

  • Complementation studies:

    • Reintroduce functional yqhA to confirm phenotype restoration

    • Express YqhA variants to identify critical residues

    • Cross-complementation with YqhA from different species to assess functional conservation

What is the relationship between YqhA and Salmonella newport's unusual ability to persist in plant environments?

Salmonella newport has been disproportionately associated with outbreaks linked to plant products, particularly tomatoes . Research on YqhA's potential role in this adaptation reveals:

  • Context within plant adaptation genes: Genome-wide mutant screens comparing S. Newport and S. Typhimurium in tomato fruit revealed that most genes required for persistence are shared between serovars and involve central metabolism functions (amino acid biosynthesis, iron acquisition, cell structure maintenance) .

  • YqhA vs. papA: While YqhA is broadly conserved, a study identified another gene, papA, unique to S. Newport Group III (present in about 25% of genomes) that contributed to fitness in tomatoes. Interestingly, papA homologs were found in plant-associated bacteria like Pantoea, Dickeya, and Pectobacterium .

  • Metabolic adaptations: S. Newport appears to have a more efficient scavenging system for purines and pyrimidines compared to S. Typhimurium when colonizing tomato pericarps, which may provide an advantage in plant environments .

  • Research approach: To determine if YqhA contributes to plant persistence, researchers could:

    • Compare fitness of YqhA mutants in plant vs. animal models

    • Analyze expression changes of yqhA during plant colonization

    • Investigate whether YqhA interacts with plant-derived compounds

How does YqhA interact with Salmonella pathogenicity islands (SPIs) and type III secretion systems?

While direct evidence for YqhA's interaction with pathogenicity islands is limited, researchers investigating this relationship should consider:

  • SPI-1 and SPI-2 function: These pathogenicity islands encode type III secretion systems crucial for host invasion and intracellular survival . Experimental approaches to study potential interactions include:

    • Creating double mutants (ΔyqhA combined with mutations in SPI-1/SPI-2 genes like invA or ssaV)

    • Examining whether YqhA expression is co-regulated with SPI genes

    • Investigating if YqhA affects the assembly or function of type III secretion systems

  • Host-specific requirements: Studies comparing host colonization found that different genetic factors may be required depending on the host:

    Host TypeCritical Genetic ElementsMethodology
    Plant hostsAmino acid biosynthesis, iron acquisitionTransposon insertion screening
    Animal hostsSPI-1, SPI-2 dependent invasionGene knockout studies, host cell invasion assays
    OystersSPI-independent mechanismsImmunohistochemistry, mutant survival assays
  • Comparative serovar analysis: Examine whether differences in YqhA sequence or expression between Salmonella serovars correlate with host preference or virulence variations .

What evolutionary insights can be gained from studying YqhA across bacterial species?

Evolutionary analysis of YqhA offers several research directions:

  • Phylogenetic distribution: YqhA is present across diverse Enterobacteriaceae, including:

    • Multiple Salmonella serovars (Newport, Typhimurium, Enteritidis, Gallinarum, etc.)

    • E. coli strains (including pathogenic variants)

    • Shigella species

  • Sequence conservation vs. functional divergence: The high sequence conservation suggests evolutionary pressure to maintain YqhA function, while small variations might indicate adaptation to different ecological niches:

    • Compare YqhA sequences from bacteria with different host preferences (plant-associated vs. animal-associated)

    • Analyze selection pressures using dN/dS ratios across the protein sequence

    • Identify potentially important residues by mapping conservation onto structural models

  • Horizontal gene transfer: Assess whether YqhA shows evidence of lateral gene movement between bacterial species:

    • Analyze GC content and codon usage of the yqhA gene region

    • Compare gene tree vs. species tree incongruencies

    • Investigate genomic context for mobile genetic elements

  • Relationship to bacteriophage resistance: Given that some Salmonella phages (like UPWr_S1-5) demonstrate host range differences across serovars , investigating whether YqhA plays a role in phage interactions could provide evolutionary insights.

What are the critical factors in designing robust experiments to study YqhA function?

For rigorous experimental investigation of YqhA, researchers should consider:

  • Genetic manipulation approaches:

    ApproachAdvantagesConsiderations
    Clean deletion mutantsPrecise genetic manipulationMay require multiple steps; potential polar effects on downstream genes
    Transposon insertionsHigh-throughput screeningMay not completely abolish protein function
    Controlled expression systemsTunable protein levelsNon-native expression can alter physiological relevance
    CRISPR-Cas9 editingPrecise and efficientRequires PAM sites; potential off-target effects
  • Functional complementation: Always include complementation controls to verify phenotypes are specifically due to YqhA:

    • Plasmid-based expression with native promoters

    • Chromosomal restoration of the gene

    • Expression of YqhA variants to identify critical domains/residues

  • Environmental conditions: Test multiple conditions relevant to Salmonella's lifecycle:

    • Different growth temperatures

    • Nutrient limitation states

    • pH variations

    • Host-relevant environments

  • Control strains: Include appropriate isogenic mutant controls with neutral mutations .

  • Technical replicates vs. biological replicates: Ensure sufficient replication of both types to establish statistical significance.

How can researchers address the challenges of working with recombinant membrane proteins like YqhA?

Membrane proteins present unique experimental challenges that researchers should address:

  • Expression optimization:

    • Test multiple expression constructs with different fusion tags

    • Optimize induction conditions (temperature, inducer concentration, time)

    • Consider specialized expression hosts for membrane proteins

    • For YqhA, E. coli and yeast systems offer good yields, while insect cells may improve folding

  • Solubilization and purification:

    • Screen detergents for optimal solubilization

    • Test different buffer compositions and pH conditions

    • Consider amphipols or nanodiscs for maintaining native-like environment

    • For YqhA, Tris-based buffers with glycerol have been optimized

  • Storage stability:

    • YqhA should be stored at -20°C or -80°C for extended periods

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

    • Consider adding glycerol (5-50%) for long-term storage

  • Functional assays:

    • Develop assays that don't require membrane extraction when possible

    • Consider whole-cell approaches for initial functional characterization

    • For interaction studies, use techniques optimized for membrane proteins

What are the most promising avenues for future research on YqhA?

Based on current knowledge gaps, future research on YqhA should prioritize:

  • Structure-function relationship: Determine the three-dimensional structure of YqhA to understand:

    • Membrane topology and orientation

    • Potential binding sites or pockets

    • Structural basis for observed sequence conservation

  • Interactome mapping: Identify proteins that interact with YqhA to place it in a functional context:

    • Use proximity labeling approaches adapted for membrane proteins

    • Screen for genetic interactions through synthetic lethality

    • Perform co-immunoprecipitation with appropriate controls for membrane proteins

  • Environmental regulation: Characterize how yqhA expression responds to different environments:

    • Transcriptomic analysis across infection-relevant conditions

    • Promoter mapping and characterization

    • Identification of transcription factors that regulate yqhA

  • Role in host-specific adaptation: Compare YqhA function across different Salmonella serovars:

    • Swap yqhA alleles between serovars to assess functional differences

    • Test fitness contributions in various host models

    • Investigate potential differences in YqhA from host-adapted vs. generalist serovars

  • Potential as a therapeutic target: Evaluate whether YqhA could serve as a target for novel antimicrobials:

    • Assess essentiality across conditions

    • Screen for inhibitors if function is established

    • Evaluate conservation to predict spectrum of activity

How can researchers integrate multi-omics approaches to better understand YqhA's role in Salmonella biology?

Modern research on YqhA should employ integrated multi-omics strategies:

  • Genomics + Transcriptomics:

    • Compare yqhA genomic context across strains with different host preferences

    • Analyze transcriptomic data to identify co-expressed genes

    • Map regulatory networks governing yqhA expression

  • Proteomics + Interactomics:

    • Use quantitative proteomics to measure YqhA levels across conditions

    • Identify post-translational modifications on YqhA

    • Map the YqhA interactome using techniques optimized for membrane proteins

  • Metabolomics + Fluxomics:

    • Assess metabolic changes in yqhA mutants

    • Investigate whether YqhA influences specific metabolic pathways

    • Track isotope-labeled metabolites to detect flux changes

  • Structural Biology + Computational Modeling:

    • Generate structural models of YqhA

    • Use molecular dynamics simulations to predict functional properties

    • Employ virtual screening to identify potential ligands or inhibitors

  • Systems Biology Integration:

    • Develop predictive models of YqhA function based on multi-omics data

    • Place YqhA in the context of cellular networks

    • Predict phenotypic outcomes of perturbations to YqhA and connected components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.