Recombinant Salmonella newport UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

The yciC protein (Gene ID: yciC, Synonyms: UPF0259 membrane protein) is a 247-amino acid membrane protein encoded by Salmonella Newport (strain SL254). Its recombinant form is produced in E. coli with an N-terminal His tag for purification purposes. Key specifications include:

ParameterDetails
Gene NameyciC
UniProt IDB4SUC3
Expression SystemE. coli
TagHis (N-terminal)
Protein LengthFull-length (1–247 amino acids)
FormLyophilized powder
Storage BufferTris/PBS-based buffer (pH 8.0) with 6% trehalose
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C (long-term); 4°C (short-term working aliquots)

Amino Acid Sequence (Partial):
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ .

Potential Functional Roles

Based on homology and Salmonella physiology, yciC may participate in:

  1. Membrane Stability: Maintenance of outer membrane integrity under stress (e.g., oxidative stress, antimicrobial treatments) .

  2. Energy Metabolism: Interaction with ETC components (e.g., Complex II, ATP synthase), as seen with YqiC in S. Typhimurium .

  3. Pathogenesis: Modulation of virulence factors (e.g., flagella, efflux pumps) through membrane-mediated signaling .

Research Applications

The recombinant yciC protein is utilized in:

ApplicationDetails
ELISA DevelopmentDetection of anti-yciC antibodies in serum samples .
Western BlottingValidation of protein expression/purification .
Membrane Interaction StudiesInvestigating protein-lipid or protein-protein interactions in Salmonella membranes .
Stress Response AnalysisStudying upregulation of yciC under oxidative or antimicrobial stress .

Stress Response and Membrane Dynamics

  • Oxidative Stress: Salmonella Newport strains upregulate genes encoding outer membrane proteins (e.g., ompA, ompC) and stress-response enzymes (e.g., sodA, katE) under plasma-activated water (PAW) treatment . While yciC itself is not directly cited, its homologs may contribute to membrane remodeling.

  • Viable but Nonculturable (VBNC) State: PAW-induced VBNC formation correlates with outer membrane vesicle secretion and ATP depletion , suggesting yciC could stabilize membranes during stress.

Homology to S. Typhimurium YqiC

  • Oligomerization: YqiC forms a homotrimer via its C-terminal coiled-coil, enabling interactions with ETC components (SdhA/B, ATP synthase) . Disruption of this trimer impairs colonization and invasion in host cells.

  • Energy Modulation: YqiC’s interaction with ETC complexes affects ATP production and flagellar assembly . Analogous roles for yciC in S. Newport remain speculative but warrant investigation.

Cross-Contamination Risks

  • Non-Human Use: Explicitly labeled as “Not For Human Consumption” due to potential biohazard risks .

Comparative Analysis with Homologs

FeatureyciC (S. Newport)YqiC (S. Typhimurium)
OligomerizationHypothetical (inferred from YqiC)Trimeric (confirmed via SEC-MALS)
ETC InteractionsSpeculative (no direct evidence)Validated (SdhA/B, ATP synthase)
Pathogenic RoleTheoretical (membrane stability, stress)Confirmed (colonization, invasion, virulence)

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advised to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This information can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciC; SNSL254_A1861; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
yciC
Target Protein Sequence
MSITAKSVYRDAGNFFRNQFITILLVSLLCAFITVVLGHAFSPSDAQIAQLSEGEHLAGS AGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGIILMIQLVSAGHRVSALRAIG ASAPALPKLFILIFLTTLLVQIGIMLIVVPGIIMAIVLALAPVMLVEEKMGVFAAMRSSM RLAWANMRLVAPAVIGWLLAKTLLLLFAPSFAVLTPNVGAVLANTLSNLISAVLLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Salmonella newport UPF0259 membrane protein yciC?

Salmonella newport UPF0259 membrane protein yciC is a transmembrane protein found in Salmonella newport strain SL254 with UniProt accession number B4SUC3. Based on its amino acid sequence, it consists of 247 amino acids with multiple hydrophobic regions that likely form transmembrane domains . The protein sequence contains characteristic features of integral membrane proteins, including hydrophobic segments that span the bacterial membrane.

While the specific function of yciC has not been fully characterized, as a membrane protein it may contribute to membrane integrity, transport functions, or potentially play a role in antimicrobial resistance mechanisms. Its presence in multidrug-resistant strains suggests it could be involved in bacterial survival mechanisms or virulence, though direct experimental evidence linking yciC to these functions requires further investigation.

What are the optimal storage conditions for recombinant Salmonella newport yciC protein?

For optimal stability and activity of recombinant Salmonella newport yciC protein, the following storage conditions are recommended:

Storage PurposeTemperatureDurationNotes
Regular storage-20°CStandard timeframeMaintains protein integrity
Extended storage-20°C or -80°CLong-termPreferred for maximum stability
Working aliquots4°CUp to one weekFor active experiments

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein's stability . Importantly, repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity, which is particularly critical for membrane proteins that are prone to aggregation.

How does yciC potentially relate to antimicrobial resistance in Salmonella newport strains?

While direct evidence linking yciC specifically to antimicrobial resistance is not established in the available research, Salmonella newport strains exhibit significant antimicrobial resistance patterns that may involve membrane proteins like yciC:

Salmonella newport MDR-AmpC isolates show resistance to at least nine antimicrobials, including extended-spectrum cephalosporins . This resistance is primarily associated with the blaCMY gene, which is present in all serotype Newport MDR-AmpC isolates and can be transferred via conjugation to other bacteria . Among examined isolates, 60% were identified as MDR-AmpC strains, with particularly high prevalence in cattle (93%), swine (70%), and human isolates (53%) .

As a membrane protein, yciC could potentially contribute to resistance through:

  • Altering membrane permeability to reduce antibiotic uptake

  • Participating in efflux pump complexes

  • Modifying the expression or function of other resistance determinants

  • Contributing to stress response mechanisms that enhance survival under antibiotic pressure

To establish a definitive connection, researchers would need to conduct gene knockout studies, expression analyses comparing resistant and susceptible strains, and functional characterization of the protein.

What methods are most effective for studying the transmembrane topology of yciC?

Investigating the transmembrane topology of yciC requires a multi-faceted approach combining computational predictions with experimental validation:

Computational approaches:

  • Hydropathy analysis using algorithms like TMHMM, Phobius, or TOPCONS to predict transmembrane segments

  • Multiple sequence alignment to identify conserved features across homologs

  • Ab initio structural prediction using tools like AlphaFold2 or I-TASSER

Experimental methods:

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine and use membrane-impermeable sulfhydryl reagents to determine which residues are accessible from which side of the membrane

  • Fusion protein approaches: Create fusions with reporter proteins (GFP, PhoA, LacZ) at various positions to determine topology based on activity or fluorescence

  • Protease protection assays: Use proteases to digest exposed regions of the protein in membrane preparations and identify protected fragments

  • Epitope mapping: Insert epitope tags at different positions and determine accessibility using antibodies

  • FRET or crosslinking studies: Probe distances between domains and interactions with lipids

The full amino acid sequence (247 amino acids) provided in search result serves as the foundation for these analyses. Combining multiple approaches provides the most reliable topology model, which is essential for understanding yciC's function.

What experimental approaches can overcome challenges in purifying recombinant yciC protein?

Purification of membrane proteins like yciC presents significant challenges. The following methodological strategies can address common issues:

Expression optimization:

  • Test multiple expression systems (E. coli C41/C43 strains, yeast, insect cells)

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Use fusion tags (MBP, SUMO, Mistic) to enhance expression and solubility

  • Consider codon optimization for the expression host

Membrane extraction:

  • Screen detergent panels (DDM, LMNG, OG) for optimal solubilization

  • Try detergent-free approaches like styrene maleic acid lipid particles (SMALPs)

  • Test native nanodiscs for maintaining native lipid environment

  • Implement gentle solubilization conditions to preserve structure

Purification workflow:

  • Multi-step chromatography approach (IMAC, ion exchange, size exclusion)

  • On-column detergent exchange to find optimal conditions

  • Add stabilizing agents (specific lipids, glycerol, cholesterol analogs)

  • Incorporate quality control steps (SEC-MALS, thermal stability assays)

For yciC specifically:
Starting with the Tris-based buffer containing 50% glycerol described in the product information provides a foundation for further optimization. Additionally, implementing strategies to verify proper folding (circular dichroism, limited proteolysis) ensures the purified protein retains its native structure and function.

How can CRISPR-based technologies be applied to investigate yciC function?

CRISPR technologies offer powerful approaches for investigating yciC function in Salmonella newport:

Gene modification strategies:

  • CRISPR-Cas9 knockout: Design guide RNAs targeting yciC to create complete gene deletions or frameshift mutations, allowing assessment of phenotypic changes related to membrane integrity, antibiotic resistance, and virulence.

  • CRISPR interference (CRISPRi): Use catalytically dead Cas9 (dCas9) fused to repressors to achieve tunable downregulation of yciC expression without permanent genetic changes.

  • Base editing: Employ Cas9 variants fused to deaminases to introduce specific point mutations without double-strand breaks, enabling study of specific amino acid contributions to protein function.

  • HDR-mediated tagging: Use CRISPR-Cas9 with homology-directed repair to introduce epitope or fluorescent tags, facilitating localization and interaction studies.

Implementation considerations:

  • Guide RNA design must account for Salmonella newport genome specificity

  • Delivery methods appropriate for Salmonella (electroporation, conjugation)

  • Phenotypic screens relevant to hypothesized functions (membrane integrity assays, antibiotic susceptibility testing)

  • Complementation controls to confirm specificity

Building on the CRISPR applications mentioned in the context of Salmonella Newport typing , these approaches can systematically dissect yciC function in its native context, providing insights beyond what traditional biochemical approaches might offer.

What role might yciC play in the emergence of persistent Salmonella Newport strains like REPJJP01?

REPJJP01 is a persistent, multidrug-resistant strain of Salmonella Newport that has caused significant illness and outbreaks in the United States since 2015 . As of September 2024, this strain has been responsible for 3,129 laboratory-confirmed infections with a 31% hospitalization rate .

While direct evidence linking yciC to REPJJP01's persistence is not established in the available research, several potential connections can be hypothesized:

  • Membrane adaptation: As a membrane protein, yciC may contribute to membrane modifications that enhance survival under environmental stresses encountered during food processing or host colonization.

  • Antimicrobial resistance: The multidrug-resistant nature of REPJJP01 suggests membrane-associated resistance mechanisms could be involved, potentially including altered expression or function of proteins like yciC.

  • Genetic diversity factors: REPJJP01 shows significant genetic diversity (within 24 allele differences by whole genome sequencing) , which could include variations in membrane protein genes like yciC that confer selective advantages.

  • Host adaptation: The strain shows a predominance among Hispanic/Latino populations (61% of cases) , suggesting potential host-specific adaptation factors that could involve membrane proteins.

Research approaches to investigate these connections could include:

  • Comparative genomic analysis of yciC sequences between REPJJP01 and non-persistent strains

  • Expression studies under conditions mimicking food production environments

  • Functional studies examining yciC's role in biofilm formation, which contributes to persistence

  • Investigation of yciC's potential contributions to host-specific colonization factors

How can subtyping methods like CRISPR-MVLST be used to track yciC variation across Salmonella Newport isolates?

CRISPR-MVLST (CRISPR-multi-virulence-locus sequence typing) represents an advanced approach for subtyping Salmonella Newport isolates that could be extended to specifically track yciC variation:

This sequence-based subtyping approach exploits the hypervariable nature of virulence genes and clustered regularly interspaced short palindromic repeats (CRISPRs) . In a study of 84 S. Newport isolates, CRISPR-MVLST identified 38 distinct sequence types (NSTs) with high discriminatory ability (>0.95), comparable to PFGE patterns .

To apply this approach specifically to yciC variation tracking:

  • Integration into MVLST schemes: yciC could be included as an additional locus in existing CRISPR-MVLST schemes, particularly if it shows discriminatory variation across isolates.

  • Correlation with resistance phenotypes: Variations in yciC sequence could be analyzed for correlation with antimicrobial resistance profiles, potentially identifying specific alleles associated with MDR strains.

  • Outbreak investigation applications: As demonstrated in a 2012 outbreak investigation , CRISPR-MVLST successfully distinguished outbreak isolates (NST 46) from sporadic cases, suggesting it could similarly track yciC-specific variations in outbreak scenarios.

  • Phylogenetic context: yciC variations could be mapped onto broader phylogenies established by CRISPR-MVLST to determine if specific variants are associated with particular clades or lineages.

This approach would be particularly valuable for tracking the evolution and spread of membrane protein variations that might contribute to emerging strains like REPJJP01, which has caused significant outbreaks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.