Recombinant Salmonella newport UPF0266 membrane protein yobD (yobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development for your order.
Synonyms
yobD; SNSL254_A1972; UPF0266 membrane protein YobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
yobD
Target Protein Sequence
MTITDLVLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKILIENQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0266 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of UPF0266 membrane protein yobD in Salmonella Newport?

The UPF0266 membrane protein family includes yobD, which represents a group of proteins with conserved functions across bacterial species. While specific functions remain under investigation, research suggests potential roles in environmental persistence and stress responses. Based on comparative studies with E. coli homologs, the protein likely contributes to membrane integrity under varying environmental conditions.

To study this protein's function, researchers should implement:

  • Comparative genomics approaches between Salmonella Newport and E. coli strains

  • Gene knockout experiments to observe phenotypic changes

  • Transcriptomic analysis under different growth conditions

  • Structural modeling based on homology with E. coli UPF0266 membrane proteins

How does the rpoS gene influence yobD expression in Salmonella Newport?

The rpoS gene encodes a sigma factor critical for stress response in Salmonella. Research has demonstrated that rpoS-deficient (ΔrpoS) Salmonella Newport strains show:

  • Diminished growth or survival decline compared to wild-type strains

  • Lower maximum population density (Nmax) in amended soil extracts

  • Inability to persist in unamended soil environments

Since RpoS regulates numerous genes involved in stress response, researchers investigating yobD should consider:

  • Comparing yobD expression levels between wild-type and ΔrpoS strains

  • Examining promoter regions for RpoS binding sites

  • Analyzing co-expression patterns with other RpoS-regulated genes

  • Measuring protein levels during different growth phases and stress conditions

What are the optimal conditions for expression and purification of recombinant Salmonella Newport yobD protein?

Based on established protocols for similar membrane proteins:

Expression Systems:

  • Baculovirus expression system provides high yield for membrane proteins

  • E. coli expression systems with specialized vectors for membrane proteins

  • Cell-free expression systems for difficult-to-express proteins

Purification Protocol:

  • Cell lysis using detergent-based methods appropriate for membrane proteins

  • Affinity chromatography using an appropriate tag (determined during manufacturing)

  • Size exclusion chromatography for final purification

  • Reconstitution in deionized sterile water to concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol as a cryoprotectant for storage

Storage Recommendations:

  • Store reconstituted protein at -20°C/-80°C with 50% glycerol

  • Expected shelf life of liquid form: 6 months at -20°C/-80°C

  • Expected shelf life of lyophilized form: 12 months at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for maximum one week

How should researchers design growth experiments to study environmental factors affecting Salmonella Newport membrane protein function?

Drawing from established methodologies:

Experimental Design Matrix:

ConditionMedia TypeStrain TypeSampling Points (hours)Parameters
Control 1Sterile, UnamendedWild-type0, 24, 48, 72, 96CFU/mL, protein expression
Control 2Sterile, UnamendedΔrpoS0, 24, 48, 72, 96CFU/mL, protein expression
Test 1Sterile, AmendedWild-type0, 24, 48, 72, 96CFU/mL, protein expression
Test 2Sterile, AmendedΔrpoS0, 24, 48, 72, 96CFU/mL, protein expression
Test 3Non-sterile, AmendedWild-type0, 24, 48, 72, 96CFU/mL, protein expression
Test 4Non-sterile, AmendedΔrpoS0, 24, 48, 72, 96CFU/mL, protein expression

Key Growth Parameters to Measure:

  • Lag phase duration (λ)

  • Maximum growth rate (μmax)

  • Maximum population density (Nmax)

Important Considerations:

  • Indigenous microbes significantly impact Salmonella Newport growth (5.94 ± 0.95 CFU/mL in non-sterile vs. 6.66 ± 1.50 CFU/mL in sterile conditions)

  • Most favorable growth conditions include amended sterile and non-sterile soil extracts

  • Growth measurements should be modeled using the Baranyi model for accurate parameter extraction

What methodological approaches can be used to study the structure-function relationship of yobD protein?

Structural Analysis Methods:

  • X-ray crystallography for high-resolution structure

  • Cryo-electron microscopy for membrane protein visualization

  • NMR spectroscopy for dynamic structural information

  • In silico modeling using homology with E. coli UPF0266 proteins

Functional Analysis Approaches:

  • Site-directed mutagenesis of conserved residues

  • Membrane localization assays using fluorescent protein fusions

  • Liposome reconstitution for functional studies

  • Protein-protein interaction mapping using crosslinking and mass spectrometry

Correlation Methods:

  • Structure-guided mutations with phenotypic assessment

  • Computational modeling of ligand binding sites

  • Evolutionary conservation analysis of functional domains

  • Comparative analysis across different bacterial species

How should researchers analyze growth data in relation to membrane protein expression?

Growth Curve Analysis:

  • Apply the Baranyi model to extract key parameters:

    • Lag phase duration (λ)

    • Maximum growth rate (μmax)

    • Maximum population density (Nmax)

Statistical Approaches:

  • Compare growth parameters across conditions using ANOVA

  • Apply appropriate post-hoc tests (e.g., Tukey's test) for multiple comparisons

  • Use P < 0.05 as threshold for statistical significance

Correlation Analysis Example Table:

Growth Conditionλ (hours)μmax (log CFU/h)Nmax (log CFU/mL)yobD Expression Level
Sterile, Amended2.86 ± 1.390.XX ± 0.XX7.XX ± 0.XXHigh
Non-sterile, Amended2.89 ± 0.660.XX ± 0.XX6.XX ± 0.XXMedium
Sterile, Unamended20.170.XX ± 0.XX5.XX ± 0.XXLow
Non-sterile, UnamendedNo growthNot applicableDeclineMinimal

Note: When growth curves cannot be modeled (as seen with unamended, non-sterile conditions), report descriptive statistics of population changes over time .

What considerations are important when comparing wild-type and ΔrpoS strains in membrane protein studies?

Key Differences to Account For:

  • ΔrpoS strains show no measurable lag phase (λ) in amended soil extracts

  • Similar maximum growth rates (μmax) between strains in favorable conditions

  • Lower maximum population density (Nmax) in ΔrpoS compared to wild-type

  • Population decline in ΔrpoS strains in unamended, non-sterile conditions

Interpretation Framework:

  • Direct effects: Changes directly attributable to rpoS deletion

  • Indirect effects: Secondary changes due to altered stress response

  • Compensatory mechanisms: Adaptations that may mask primary effects

  • Environmental interactions: Different responses to environmental variables

Important Controls:

  • Complementation studies to confirm phenotype is due to rpoS deletion

  • Time-course sampling to capture dynamic changes

  • Multiple biological replicates to account for variability

  • Measurement of multiple membrane proteins to distinguish specific from general effects

How might yobD function contribute to antimicrobial resistance in Salmonella Newport?

Research Context:
Newport-MDRAmpC represents a multidrug-resistant strain of Salmonella Newport that has emerged in recent years. Case-control studies have identified:

  • Higher risk of infection in patients who had taken antimicrobials to which Newport-MDRAmpC is resistant (OR, 5.0 [95% CI, 1.6-16])

  • Association with consumption of uncooked ground beef (OR, 7.8 [95% CI, 1.4-44])

  • Association with consumption of runny eggs prepared at home (OR, 4.9 [95% CI, 1.3-19])

Experimental Approaches:

  • Compare yobD expression levels between susceptible and resistant strains

  • Generate yobD knockout mutants and assess changes in antibiotic susceptibility

  • Perform membrane permeability assays with various antibiotics

  • Conduct protein interaction studies to identify partners in resistance mechanisms

Methodological Table for Resistance Studies:

ApproachMethodologyOutcome MeasuresControls
Gene expressionRT-qPCR, RNA-SeqFold-change in yobD expressionHousekeeping genes
Protein levelsWestern blot, proteomicsRelative abundanceTotal protein normalization
FunctionalMIC determinationChange in antibiotic susceptibilityComplemented mutants
StructuralMembrane integrity assaysPermeability changesKnown membrane disruptors

What are the latest techniques for studying membrane protein dynamics in changing environmental conditions?

Cutting-Edge Methodologies:

  • Advanced Imaging Techniques:

    • Super-resolution microscopy for protein localization

    • Single-molecule tracking for real-time dynamics

    • FRET-based biosensors for conformational changes

    • Correlative light-electron microscopy for structure-function relationships

  • Molecular Dynamics:

    • All-atom simulations in membrane environments

    • Coarse-grained models for longer timescales

    • Enhanced sampling techniques for rare events

    • Integration with experimental structural data

  • Systems Biology Approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis of protein-protein interactions

    • Machine learning for pattern recognition in complex datasets

    • Mathematical modeling of membrane protein dynamics

  • Genetic Technologies:

    • CRISPR-Cas9 for precise genetic manipulation

    • Inducible expression systems for temporal control

    • Fluorescent protein tagging for localization studies

    • Ribosome profiling for translational efficiency assessment

How do environmental adaptation mechanisms in Salmonella Newport relate to membrane protein function?

Environmental Adaptation Factors:
Research has shown that Salmonella Newport demonstrates remarkable adaptability to different environments:

  • Growth in amended soil extracts increases by 4-5 log CFU/mL within 96 hours

  • Indigenous microbes significantly impact growth potential

  • RpoS plays a critical role in survival under nutrient-limited conditions

Membrane Protein Involvement Hypotheses:

  • Nutrient Acquisition: Membrane proteins may facilitate uptake of specific nutrients from amended soil extracts

  • Competitive Advantage: Expression of certain membrane proteins might provide advantages against indigenous microbes

  • Stress Response: Membrane proteins could maintain envelope integrity under environmental stresses

  • Signaling: Membrane sensors may detect environmental changes and trigger adaptive responses

Research Design for Hypothesis Testing:

  • Compare membrane proteome across different environmental conditions

  • Correlate specific protein expression with growth parameters

  • Generate knockout mutants for key membrane proteins

  • Test survival and competitive fitness in relevant environmental models

What methods are most effective for determining the physiological role of yobD in Salmonella Newport?

Genetic Approaches:

  • Creation of clean deletion mutants using λ Red recombination

  • Complementation studies with controlled expression vectors

  • Site-directed mutagenesis of conserved residues

  • Construction of reporter fusions for expression analysis

Biochemical Methods:

  • Protein-protein interaction studies (pull-down assays, crosslinking)

  • Substrate binding assays if transport function is suspected

  • Membrane integrity assessments

  • Lipid interaction studies

Physiological Assays:

  • Growth curve analysis under various stress conditions

  • Competition assays with wild-type strains

  • Survival studies in relevant environmental models

  • Host cell interaction studies if pathogenicity is of interest

Integrative Approach: Combine multiple lines of evidence from genetic, biochemical, and physiological studies to build a comprehensive model of yobD function. Consider evolutionary conservation across Salmonella species and related enterobacteria to identify core functions versus species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.