Recombinant Salmonella newport UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order remarks if needed. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycjF; SNSL254_A1808; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
ycjF
Target Protein Sequence
MSEPLKPRIDFAEPLKEEPTSAFKAQQTFSEAESRTFAPAAIDERPEDEGVAEAAVDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARELLHSHSVGKGRAFCEKLAQQAGIDQSHPALQRWYAAIHE TQNDREIVGLYANLVQPVLDAQARREISRFAAESTLMIVVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFRLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDNDKPRLGDFRRQLIGQLKETLQKSKSSPEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant ycjF protein?

Based on established protocols, E. coli is the recommended expression system for recombinant Salmonella newport ycjF protein. The protein can be efficiently expressed with an N-terminal His tag, which facilitates subsequent purification through affinity chromatography. The E. coli expression system allows for production of the full-length protein (1-353 amino acids) with high yield and purity .

What are the optimal storage conditions for purified ycjF protein?

For optimal stability and activity retention, purified ycjF protein should be stored as follows:

Storage ParameterRecommended ConditionNotes
Short-term storage4°CSuitable for up to one week
Long-term storage-20°C to -80°CAliquoting necessary
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
FormLyophilized powder or reconstituted solution with 5-50% glycerolDefault final concentration of glycerol: 50%

Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and function .

What is the basic reconstitution protocol for lyophilized ycjF protein?

The recommended reconstitution protocol involves:

  • Brief centrifugation of the vial prior to opening to bring contents to the bottom

  • Reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Adding glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquoting for long-term storage at -20°C/-80°C to avoid freeze-thaw cycles

What techniques are recommended for studying the membrane topology of ycjF protein?

For investigating the membrane topology of ycjF protein, researchers should consider a multi-methodological approach:

  • Computational prediction: Begin with transmembrane domain prediction algorithms (TMHMM, Phobius, MEMSAT) to establish the theoretical topology model

  • Cysteine scanning mutagenesis: Systematically replace non-essential residues with cysteine, then use membrane-impermeable sulfhydryl reagents to determine which residues are accessible from which side of the membrane

  • Fluorescence protease protection (FPP) assay: Tag different domains with fluorescent proteins and measure protease accessibility to determine cytoplasmic versus periplasmic orientation

  • Cryo-electron microscopy: For high-resolution structural determination of membrane protein organization

When generating topological models, it's critical to validate predictions with at least two complementary experimental approaches to resolve potential discrepancies between computational predictions and actual protein folding in bacterial membranes.

How might ycjF protein contribute to Salmonella Newport pathogenesis?

While the exact function of ycjF in Salmonella Newport pathogenesis remains under investigation, research approaches to determine its role should include:

  • Gene knockout studies: Create ycjF deletion mutants and assess virulence in appropriate infection models

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and ycjF mutants under various conditions relevant to infection (e.g., acidic pH, nutrient limitation, host cell contact)

  • Protein-protein interaction studies: Identify potential binding partners through techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or crosslinking mass spectrometry

  • Location-specific expression analysis: Determine if ycjF expression changes during different stages of infection using reporter constructs

The UPF0283 family of membrane proteins has structural features suggesting potential roles in membrane transport, stress response, or signal transduction pathways that could be relevant to bacterial survival during infection .

What methods are most effective for studying protein-protein interactions involving membrane-bound ycjF?

Studying protein-protein interactions involving membrane proteins like ycjF requires specialized approaches:

MethodAdvantagesLimitationsBest Application
Membrane-based bacterial two-hybridIn vivo detection of interactionsLimited to binary interactionsInitial screening
Crosslinking mass spectrometryCaptures transient interactionsComplex data analysisIdentification of interaction landscapes
Co-immunoprecipitation with membrane solubilizationPreserves native complexesRequires effective antibodiesValidation of specific interactions
Bioluminescence resonance energy transfer (BRET)Real-time monitoring in live cellsRequires genetic manipulationDynamic interaction studies
Surface plasmon resonance (SPR)Quantitative binding kineticsRequires purified proteinsDetailed binding characterization

When designing protein interaction studies for ycjF, researchers should consider using detergent mixes optimized for membrane proteins to ensure proper solubilization without disrupting biologically relevant interactions.

What genomic approaches can reveal the evolutionary conservation and variation of ycjF across Salmonella lineages?

To investigate evolutionary patterns of ycjF across Salmonella lineages, researchers should employ:

  • Comparative genomic analysis: Align ycjF sequences from diverse Salmonella isolates to identify conserved and variable regions

  • Selection pressure analysis: Calculate dN/dS ratios to determine if the gene is under purifying, neutral, or positive selection

  • Phylogenetic reconstruction: Build gene trees based on ycjF sequences and compare with species trees to detect potential horizontal gene transfer events

  • Pangenome analysis: Determine if ycjF is part of the core or accessory genome across Salmonella lineages

Recent studies of Salmonella Newport have shown that each lineage has a closed pangenome with a large number of core genes, indicating the lineages underwent limited horizontal transfer . Analyzing where ycjF fits within this genomic architecture can provide insights into its functional importance.

What are the critical quality control parameters for recombinant ycjF protein preparations?

Researchers working with recombinant ycjF should implement the following quality control measures:

  • Purity assessment: SDS-PAGE analysis should confirm >90% purity as standard for functional studies

  • Endotoxin testing: Critical for preparations intended for immunological studies or in vivo experiments

  • Verification of intact sequence: Mass spectrometry to confirm the expected molecular weight and protein sequence

  • Functional activity assays: Development of specific assays based on hypothesized function

  • Secondary structure analysis: Circular dichroism spectroscopy to confirm proper protein folding

  • Aggregation state assessment: Size-exclusion chromatography or dynamic light scattering to verify monodispersity

How can researchers optimize heterologous expression of ycjF to maximize yield and proper folding?

Optimization strategies for heterologous expression of membrane proteins like ycjF include:

  • Expression strain selection: Test multiple E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), Lemo21(DE3))

  • Induction parameters: Optimize temperature (typically lowered to 16-25°C), inducer concentration, and induction duration

  • Media formulation: Supplementation with specific additives such as glycerol (0.5-2%) or specific metal ions if required for protein folding

  • Chaperone co-expression: Co-express molecular chaperones to assist proper membrane protein folding

  • Fusion partners: Test various fusion tags beyond His-tag that may enhance solubility and membrane integration

A systematic approach testing multiple conditions in parallel is recommended, with protein quality (proper folding) prioritized over absolute yield.

What controls and validation steps are necessary when studying potential horizontal transfer of plasmids containing ycjF?

When investigating horizontal transfer of plasmids potentially containing ycjF:

  • Phylogenetic analysis: Compare chromosomal versus plasmid-borne ycjF sequences to detect incongruences that may indicate horizontal transfer

  • Control strains: Include related strains both with and without the suspected horizontally transferred elements

  • Plasmid isolation and characterization: Fully sequence and characterize plasmids from multiple isolates to determine similarity

  • Transfer frequency measurement: Quantitative conjugation or transformation assays under different environmental conditions

  • Selective marker validation: Ensure selective markers used do not interfere with natural transfer mechanisms

  • Environmental controls: Replicate conditions relevant to the bacterial habitat to assess ecological relevance of transfer

Studies have shown that analyzing horizontally transferred plasmids can provide evidence for connections between bacterial isolates from different sources, which may be particularly relevant for understanding Salmonella ecology .

How should researchers address conflicting results in ycjF functional studies?

When faced with conflicting results in ycjF functional studies:

  • Methodological comparison: Systematically analyze differences in experimental approaches, expression systems, tags, and buffer conditions

  • Strain-specific effects: Determine if discrepancies might be attributed to differences between Salmonella strains or isolates

  • Condition-dependent function: Test if the protein's function varies under different environmental conditions (pH, temperature, nutrient availability)

  • Interaction partners: Investigate if the presence or absence of specific interaction partners explains functional differences

  • Meta-analysis: Conduct a formal meta-analysis of available data using standardized effect sizes

  • Orthogonal validation: Employ multiple independent techniques to verify contentious findings

What statistical approaches are most appropriate for analyzing membrane protein localization data?

For rigorous analysis of membrane protein localization data:

  • Replicate requirements: Minimum of 3 biological replicates and 3 technical replicates per condition

  • Normalization strategies:

    • For fluorescence data: Normalize to membrane markers or total protein content

    • For fractionation studies: Use established membrane and cytoplasmic markers as controls

  • Statistical tests:

    • For comparing localization across conditions: ANOVA with appropriate post-hoc tests

    • For co-localization analysis: Pearson's or Mander's correlation coefficients

    • For time-course studies: Repeated measures ANOVA or mixed-effects models

  • Quantification methods:

    • Fluorescence intensity profiles across cell compartments

    • Calculation of enrichment ratios between membrane and cytoplasmic fractions

    • Coefficient of variation to assess distribution homogeneity

  • Visualization: Box plots, violin plots, or cumulative distribution functions rather than simple bar graphs

How can researchers integrate ycjF data with broader Salmonella Newport genomic information?

To effectively integrate ycjF data with broader genomic contexts:

  • Genomic neighborhood analysis: Examine conservation of genes surrounding ycjF across strains to identify potential operons or functional clusters

  • Co-expression networks: Build gene co-expression networks from transcriptomic data to identify genes with expression patterns correlated with ycjF

  • Regulatory element identification: Analyze upstream regions for transcription factor binding sites and other regulatory elements

  • Pathway enrichment analysis: Determine if genes co-regulated with ycjF are enriched in specific metabolic or virulence pathways

  • Multi-omics integration: Combine proteomics, transcriptomics, and genomics data using statistical integration methods like MOFA (Multi-Omics Factor Analysis) or DIABLO (Data Integration Analysis for Biomarker discovery using Latent cOmponents)

Studies of Salmonella Newport have revealed that different lineages have closed pangenomes with substantial core genes, and analysis of ycjF within this context can provide insights into its evolutionary and functional significance .

What mass spectrometry approaches are most suitable for studying post-translational modifications of ycjF?

For comprehensive analysis of post-translational modifications (PTMs) in ycjF:

  • Sample preparation protocols:

    • Enrichment strategies for specific PTMs (phosphoenrichment, glycopeptide enrichment)

    • Multiple proteases beyond trypsin (chymotrypsin, Glu-C) to improve sequence coverage

    • Specialized membrane protein solubilization protocols

  • MS techniques:

    • Electron transfer dissociation (ETD) or electron capture dissociation (ECD) for labile PTM analysis

    • High-resolution MS/MS with instruments capable of 120,000+ resolution at 200 m/z

    • Parallel reaction monitoring (PRM) for targeted quantification of modified peptides

  • Data analysis workflow:

    • Open search approaches to identify unexpected modifications

    • PTM localization score calculations

    • Site occupancy determination through label-free or labeled quantification

  • Validation strategies:

    • Site-directed mutagenesis of identified PTM sites

    • Antibodies against specific PTMs where available

    • Functional assays with PTM-mimicking mutations

What approaches can reveal the structural dynamics of ycjF in membrane environments?

To investigate structural dynamics of ycjF within membranes:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Measures solvent accessibility and structural flexibility of different protein regions

  • Site-directed spin labeling with electron paramagnetic resonance (EPR): Provides information about local dynamics and distances between protein domains

  • Molecular dynamics simulations: Computational modeling of protein behavior within simulated lipid bilayers

  • Single-molecule FRET: Measures distances between labeled domains to track conformational changes under different conditions

  • Solid-state NMR: Provides atomic-level structural information of membrane proteins in native-like lipid environments

These techniques can be particularly valuable for understanding how ycjF might change conformation during potential functional activities such as transport or signaling.

How can researchers effectively collaborate across disciplines to characterize ycjF function?

Effective interdisciplinary collaboration for ycjF characterization requires:

  • Team composition: Combine expertise from structural biology, microbiology, biochemistry, computational biology, and infection biology

  • Shared resources and protocols:

    • Standardized expression and purification protocols

    • Common strain collections and plasmid repositories

    • Shared data formats and analysis pipelines

  • Complementary methodological approaches:

    • Structural biology teams: Provide information about protein folding and domains

    • Microbiologists: Study phenotypic effects of gene deletion or overexpression

    • Biochemists: Characterize enzymatic or binding activities

    • Computational biologists: Predict function and analyze evolutionary patterns

    • Infection biologists: Assess relevance to pathogenesis

  • Integrated data management:

    • Centralized data repositories with standardized metadata

    • Regular data sharing and integration meetings

    • Collaborative electronic lab notebooks

The study of bacterial membrane proteins like ycjF particularly benefits from cross-disciplinary approaches that can address the technical challenges associated with their characterization.

What model systems are most appropriate for studying ycjF function in the context of Salmonella pathogenesis?

Selection of appropriate model systems for studying ycjF in pathogenesis should consider:

Model SystemAdvantagesLimitationsBest Applications
Cell culture modelsControlled conditions, high throughputLimited complexityInitial screening, mechanism studies
Galleria mellonellaEthical advantages, cost-effectiveLimited immune system homologyPreliminary virulence assessment
Mouse modelsMammalian physiology, well-characterizedEthical considerations, costIn vivo pathogenesis studies
OrganoidsHuman tissue-specific responsesTechnical complexityHost-specific interactions
Microfluidic gut-on-chipDynamic conditions, controlled microenvironmentComplex setup, limited throughputHost-microbiome interactions

The choice of model system should be guided by the specific research questions about ycjF function, with appropriate controls and validation across multiple systems where possible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.