Recombinant Salmonella newport UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its inclusion in development.
Synonyms
yjjB; SNSL254_A4900; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
yjjB
Target Protein Sequence
MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links
Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is UPF0442 protein yjjB in Salmonella Newport?

    UPF0442 protein yjjB is a 157-amino acid membrane protein belonging to the UPF0442 family expressed in Salmonella enterica strains, including Salmonella Newport. According to structural data, it functions as a multi-pass membrane protein with high structural confidence (pLDDT global score of 93) . The protein contains several transmembrane domains that form a characteristic fold pattern essential for its cellular function. Current evidence suggests it may play a role in membrane transport or cellular processes unique to Salmonella species, though its precise biological function remains under investigation.

  • Which expression systems are most effective for recombinant production of yjjB protein?

    Multiple expression systems have been validated for recombinant yjjB production, with each offering distinct advantages depending on research requirements:

    Expression SystemAdvantagesConsiderationsOptimal Applications
    E. coliHighest yields, rapid production, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
    YeastGood yields, eukaryotic modificationsLonger production time than E. coliFunctional studies requiring some modifications
    Insect cellsProper protein folding, most post-translational modificationsLower yields, higher costActivity assays, interaction studies
    Mammalian cellsNative-like modifications, proper foldingLowest yields, highest cost, longest production timeStudies requiring fully functional protein

    For most basic research applications, E. coli expression systems provide sufficient yield and quality, with the protein typically expressed with an N-terminal His-tag to facilitate purification . For studies requiring proper folding and post-translational modifications, insect or mammalian expression systems may be preferable despite their higher cost and lower yield .

  • What are the recommended storage and reconstitution protocols for recombinant yjjB protein?

    For optimal stability and activity maintenance of recombinant yjjB protein, the following protocols are recommended:

    Storage Protocol:

    • Store lyophilized protein at -20°C or -80°C for long-term stability

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • Working aliquots can be stored at 4°C for up to one week

    • For reconstituted protein, the addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage

    Reconstitution Method:

    • Briefly centrifuge vial prior to opening to collect all material at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Allow protein to dissolve completely by gentle mixing

    • For buffer exchange or higher concentration requirements, utilize centrifugal concentrators with appropriate molecular weight cutoffs

    Following these protocols ensures maximum retention of protein structure and function for experimental applications.

  • What is the predicted structure of UPF0442 protein yjjB?

    The predicted structure of UPF0442 protein yjjB has been computed using AlphaFold and is available in the AlphaFold DB (AF-Q57G59-F1, released 2021-12-09, last modified 2022-09-30). The model demonstrates a very high confidence level with a global pLDDT score of 93, indicating a reliable structure prediction .

    The protein adopts a multi-pass transmembrane configuration with several alpha-helical domains spanning the membrane. These transmembrane helices are connected by short loop regions. The high confidence score suggests that most regions of the protein have well-defined secondary and tertiary structure elements. The model predicts that yjjB likely functions as an integral membrane protein, potentially involved in transport or signaling processes across the bacterial cell membrane .

    While this structure model provides valuable insights, it's important to note that there are currently no experimental structures (X-ray crystallography or NMR) available to verify the accuracy of this computational model.

Advanced Research Questions

  • What experimental design approaches are optimal for functional characterization of yjjB protein?

    For comprehensive functional characterization of yjjB protein, a multi-faceted experimental design approach is recommended:

    Within-subjects vs. Between-subjects Design:
    When investigating the effects of yjjB expression on bacterial phenotypes, a between-subjects design comparing wild-type and yjjB knockout strains is most appropriate for establishing causal relationships . For studying protein interactions or responses to environmental conditions, a within-subjects design measuring the same bacterial population under multiple conditions provides greater statistical power .

    Factorial Design for Interaction Studies:
    A full factorial design examining multiple factors simultaneously is recommended to understand how yjjB function may be modulated by environmental conditions. For example, a 3×2 factorial design examining three levels of osmotic stress (none, moderate, high) against two growth temperatures would efficiently identify interaction effects .

    Methodological Approaches:

    1. Gene knockout/complementation studies to establish phenotypic effects

    2. Site-directed mutagenesis of conserved residues to determine functional regions

    3. Subcellular localization using fluorescently-tagged constructs

    4. Protein-protein interaction studies using pull-down assays or bacterial two-hybrid systems

    5. Transcriptomic and proteomic analyses in yjjB mutant backgrounds to identify affected pathways

    This systematic approach enables researchers to establish both the biological function of yjjB and its mechanistic role within bacterial cellular processes.

  • How can researchers investigate potential roles of yjjB in Salmonella Newport pathogenicity?

    Investigating yjjB's potential role in Salmonella Newport pathogenicity requires multiple complementary approaches:

    In Vitro Infection Models:

    • Epithelial cell invasion assays comparing wild-type and yjjB mutant strains to assess invasion efficiency

    • Macrophage survival assays to determine if yjjB contributes to intracellular persistence

    • Biofilm formation assays to evaluate potential roles in environmental persistence

    Gene Expression Analysis:

    • RNA-seq or qRT-PCR to examine if yjjB expression is upregulated during infection or under host-mimicking conditions

    • Promoter-reporter fusion studies to identify environmental triggers of yjjB expression

    Comparative Genomics:

    • Analysis of yjjB sequence conservation across Salmonella serovars with different virulence profiles

    • Examination of genetic linkage to known virulence factors

    In Vivo Studies:

    • Mouse infection models comparing colonization, persistence, and disease severity between wild-type and yjjB-deficient strains

    • Competitive index assays to quantify fitness contributions during infection

    These approaches should be considered in the context of what is known about Salmonella Newport epidemiology. Since Newport is the third most common Salmonella serotype causing human infections in the United States (representing approximately 8% of infections reported in 2013) , understanding virulence factors specific to this serotype has significant public health implications.

  • What methods can be used to investigate potential membrane transport functions of yjjB?

    As a predicted multi-pass membrane protein, yjjB may function in membrane transport. The following methodological approaches can be employed to investigate this hypothesis:

    Liposome Reconstitution Assays:

    • Purified recombinant yjjB can be reconstituted into liposomes loaded with fluorescent dyes or radioactive substrates

    • Transport activity can be measured by monitoring substrate flux across the membrane under varying conditions

    • This approach allows testing of candidate substrates including ions, small molecules, or metabolites

    Electrophysiological Techniques:

    • Patch-clamp recordings of bacterial spheroplasts expressing yjjB to detect ion channel activity

    • Planar lipid bilayer experiments with purified protein to characterize potential channel properties

    Substrate Binding Studies:

    • Thermal shift assays to identify ligands that stabilize protein structure

    • Isothermal titration calorimetry to determine binding constants for potential substrates

    • Photoreactive substrate analogs for covalent labeling of binding sites

    Phenotypic Characterization:

    • Growth phenotypes of yjjB mutants under varying osmotic, pH, or nutrient conditions

    • Metabolomic profiling to identify accumulated or depleted metabolites in mutant strains

    Structure-Function Analysis:

    • Site-directed mutagenesis of conserved residues within predicted pore-forming regions

    • Molecular dynamics simulations based on the AlphaFold structure to model potential transport pathways

    These methodologies should be applied systematically, beginning with phenotypic screens to narrow potential substrate classes, followed by more targeted biochemical and biophysical approaches.

  • What approaches can be used for comparative analysis of yjjB proteins across different Salmonella strains?

    Comparative analysis of yjjB proteins across different Salmonella strains provides valuable insights into evolution, specialization, and potential functional differences. The following approaches are recommended:

    Sequence-Based Comparative Analysis:

    • Multiple sequence alignment of yjjB homologs from diverse Salmonella serovars, including analysis of conservation patterns

    • Phylogenetic analysis to map evolutionary relationships and identify potential adaptive changes

    • Calculation of selection pressures (dN/dS ratios) across different protein regions to identify sites under positive selection

    Structure-Based Comparison:

    • Homology modeling of yjjB variants based on the AlphaFold structure

    • Comparison of predicted structural differences, particularly in regions facing the membrane or forming potential substrate binding sites

    • Molecular dynamics simulations to assess potential differences in flexibility or conformational states

    Functional Complementation:

    • Cross-complementation experiments where yjjB from different serovars is expressed in a common knockout background

    • Assessment of whether observed phenotypes can be rescued by heterologous expression

    • Identification of serovar-specific functional differences through complementation efficacy

    Expression Pattern Analysis:

    • Comparison of yjjB expression patterns across different serovars under identical conditions

    • Investigation of potential regulatory differences affecting expression timing or levels

    • Correlation of expression patterns with serovar-specific niches or pathogenicity profiles

    This multi-layered comparative approach can reveal whether yjjB functions are conserved across Salmonella species or if the protein has undergone specialization in certain lineages, potentially contributing to serovar-specific adaptations.

  • How does antimicrobial resistance in Salmonella Newport relate to potential yjjB functions?

    While direct evidence linking yjjB to antimicrobial resistance in Salmonella Newport is currently limited, several research approaches can explore potential relationships:

    Correlation Studies:

    • Analysis of yjjB sequence variations between antimicrobial-susceptible and resistant Newport strains

    • Transcriptomic comparison of yjjB expression levels between susceptible and resistant isolates under antibiotic exposure

    • Investigation of genetic linkage between yjjB and known resistance determinants

    Experimental Approaches:

    • Assessment of minimum inhibitory concentrations (MICs) for various antibiotics in wild-type vs. yjjB mutant strains

    • Evaluation of antibiotic accumulation in cells with normal vs. altered yjjB expression

    • Examination of potential interactions between yjjB and efflux pump components

    Contextual Epidemiological Information:
    Researchers should consider the epidemiological context of Salmonella Newport resistance patterns. Studies have shown that approximately 88% of clinical Newport isolates are pansusceptible to tested antimicrobials, while 8% demonstrate resistance to at least seven agents, including ceftriaxone . This bimodal distribution of resistance profiles suggests distinct lineages or acquired resistance mechanisms that could potentially involve membrane proteins like yjjB.

    Understanding the relationship between yjjB and antimicrobial resistance is particularly relevant given that multidrug-resistant Salmonella Newport remains linked to travel to Mexico and U.S. beef products as of 2021-2022 , highlighting ongoing public health concerns associated with this pathogen.

Research Methods Table

Research QuestionRecommended MethodsExpected OutcomesTechnical Considerations
Protein StructureX-ray crystallography, Cryo-EM, NMRExperimental validation of AlphaFold predictionMembrane protein crystallization challenges
Cellular LocalizationFluorescent protein fusions, Immunogold labelingConfirmation of membrane localization patternPotential tag interference with function
Protein InteractionsBacterial two-hybrid, Co-immunoprecipitation, Crosslinking-MSIdentification of interaction partnersMembrane protein solubilization issues
Transport FunctionLiposome reconstitution, ElectrophysiologySubstrate identification and kinetic parametersProtein orientation in reconstituted systems
Gene RegulationRNA-seq, ChIP-seq, Reporter fusionsRegulatory network identificationGrowth condition optimization
Virulence ContributionAnimal infection models, Cell invasion assaysQuantified contribution to pathogenicityEthical considerations in animal models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.