Recombinant Salmonella newport Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
zntB; SNSL254_A1777; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Salmonella newport (strain SL254)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWLLDGRGGVKPLEDNDVIDSQHPCWLHLNYTHPDSARWLASTP LLPNNVRDALAGESSRPRVSRMGEGTLITLRCINGSTDERPDQLVAMRLYMDERFIVSTR QRKVLALDDVVSDLQEGTGPVDCGSWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDHRRRMQDIADRLGRGLDE IDACIARTGIMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWR FGFSLFCILLVVLIGGVTLWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its primary function in Salmonella species?

ZntB is a zinc transport protein found in Salmonella species that functions primarily as a zinc efflux system. The protein belongs to the CorA family of cation transporters but has evolved to specialize in zinc transport rather than magnesium transport like other CorA family members. ZntB plays a critical role in zinc homeostasis by mediating the efflux of zinc ions when intracellular concentrations become elevated, thereby protecting the cell from zinc toxicity .

To investigate ZntB function experimentally, researchers typically employ gene knockout studies and complementation assays. For example, in studies with Salmonella enterica serovar Typhimurium, mutations in the zntB locus resulted in increased sensitivity to cytotoxic levels of zinc and cadmium, with the mutant strain showing half-maximal growth at 20 μM Zn²⁺ compared to 60 μM Zn²⁺ for wild-type strains . This phenotype was partially rescued by introducing a plasmid containing the wild-type zntB allele, confirming ZntB's role in zinc tolerance.

How does the structure of ZntB relate to its transport function?

The ZntB protein has a distinctive funnel-like structure similar to that of the homologous Thermotoga maritima CorA Mg²⁺ channel. Crystal structures of ZntB cytoplasmic domains from Salmonella enterica serovar Typhimurium (StZntB) have been determined in both dimeric and homopentameric forms at 2.3 Å and 3.1 Å resolutions, respectively . The pentameric assembly is considered physiologically relevant.

A key structural feature distinguishing ZntB from related transporters is the orientation of its central α7 helix, which forms the inner wall of the funnel. In StZntB, this helix is oriented perpendicular to the membrane, unlike the angled orientation seen in CorA or Vibrio parahaemolyticus ZntB. This structural difference results in a cylindrical pore rather than a tapered one, which may represent an "open" conformation conducive to zinc efflux .

Transport assays with ⁶⁵Zn²⁺ have demonstrated that ZntB facilitates zinc efflux rather than uptake. Experiments showed that strains with functional ZntB exhibited efflux rates 5-8.8 times greater than transport-deficient strains, confirming its role in zinc extrusion .

What are the optimal storage conditions for recombinant ZntB protein?

For recombinant ZntB protein, optimal storage conditions include:

Storage PurposeTemperatureBuffer ConditionsMaximum DurationSpecial Considerations
Long-term storage-80°CTris-based buffer with 50% glycerolMonths to yearsAvoid repeated freeze-thaw cycles
Medium-term storage-20°CTris-based buffer with 50% glycerolSeveral monthsAliquot before freezing
Working storage4°CTris-based bufferUp to one weekMinimize exposure to light

The protein is typically stored in a Tris-based buffer optimized for stability, containing 50% glycerol to prevent ice crystal formation that could denature the protein . For extended storage, it's recommended to keep the protein at -20°C or -80°C. Working aliquots can be maintained at 4°C for up to one week. It's important to note that repeated freezing and thawing should be avoided as this can lead to protein degradation and loss of activity .

How do mutations in the zntB gene affect zinc homeostasis and bacterial survival?

Mutations in the zntB gene have significant implications for zinc homeostasis and bacterial survival, particularly under zinc stress conditions. Disruption of the zntB locus in Salmonella enterica serovar Typhimurium results in hypersensitivity to zinc and cadmium, as demonstrated through disk diffusion assays and growth characterization studies .

Quantitative analysis shows that zntB mutants display:

StrainHalf-maximal Growth at Zn²⁺ ConcentrationRelative Zinc AccumulationRelative Zinc Efflux Rate
Wild-type60 μM1.0 (reference)5-fold over transport-deficient
zntB mutant20 μM1.2-fold higherSimilar to transport-deficient
Complemented mutant45 μM1.1-fold higher8.8-fold over transport-deficient

The increased zinc sensitivity in mutants appears to be specifically related to impaired efflux capacity. Transport assays with ⁶⁵Zn²⁺ have shown that zntB mutations diminish the capacity to extrude zinc without significantly affecting uptake activity . This suggests that ZntB's primary role is in zinc efflux rather than influx.

To investigate these effects experimentally, researchers can employ growth curve analyses in media supplemented with varying concentrations of zinc, radioactive zinc transport assays to measure influx and efflux rates, and real-time PCR to examine compensatory expression of other zinc transport systems.

What are the key differences between ZntB and other members of the CorA family of transporters?

Despite its homology to the CorA family of transporters, ZntB exhibits several distinct functional and structural characteristics:

  • Ion Specificity: While CorA primarily transports Mg²⁺ ions, ZntB specializes in the transport of Zn²⁺ and possibly Cd²⁺ ions .

  • Transport Direction: CorA functions as both an influx and efflux pathway for Mg²⁺, whereas ZntB appears to function primarily as an efflux system for Zn²⁺ .

  • Structural Differences:

    • The central α7 helix in StZntB is oriented perpendicular to the membrane, unlike the angled orientation in CorA

    • This results in a cylindrical pore in ZntB rather than the tapered pore seen in CorA

    • These structural differences likely contribute to the difference in ion selectivity and transport directionality

  • Functional Complementation: Unlike CorA, ZntB cannot rescue the Mg²⁺-dependent growth phenotype of a strain deficient in all known Mg²⁺ transport systems (MM281) . This was demonstrated experimentally by introducing a plasmid encoding ZntB into MM281, which failed to alter the strain's Mg²⁺ dependence.

To experimentally investigate these differences, researchers can employ X-ray crystallography, isothermal titration calorimetry, electrophysiology, and site-directed mutagenesis to identify residues critical for ion selectivity and transport direction.

What experimental approaches can be used to study ZntB-mediated zinc transport in vivo?

Several experimental approaches can be employed to study ZntB-mediated zinc transport in living bacterial cells:

  • Radioactive ⁶⁵Zn²⁺ Transport Assays:

    • For efflux measurements: Preload cells with ⁶⁵Zn²⁺, then measure the rate of ⁶⁵Zn²⁺ release into the medium

    • For uptake measurements: Expose cells to ⁶⁵Zn²⁺ and measure intracellular accumulation over time

    • Compare wild-type, mutant, and complemented strains to quantify ZntB's contribution

  • Fluorescent Zinc Probes:

    • Use zinc-sensitive fluorescent probes (such as FluoZin-3) to monitor intracellular zinc concentration changes in real-time

    • This allows for non-radioactive assessment of transport kinetics

  • Growth Phenotype Assays:

    • Culture bacteria in media with varying concentrations of zinc

    • Generate dose-response curves for growth parameters

    • Compare EC₅₀ values between wild-type and mutant strains

  • Gene Expression Analysis:

    • Use qRT-PCR or RNA-seq to monitor expression of zntB and other zinc homeostasis genes under different zinc conditions

    • Identify regulatory networks controlling ZntB expression

  • In vivo Protein Interaction Studies:

    • Employ bacterial two-hybrid systems or co-immunoprecipitation to identify proteins that interact with ZntB

    • This can reveal functional partnerships in zinc homeostasis

A comprehensive experimental design might combine these approaches to provide a multi-faceted understanding of ZntB function in vivo.

How can crystal structures of ZntB inform the design of transport inhibitors?

The available crystal structures of ZntB cytoplasmic domains from Salmonella enterica serovar Typhimurium provide valuable information for the rational design of transport inhibitors . This approach is particularly relevant for developing new antimicrobial agents, as zinc homeostasis is essential for bacterial virulence and survival.

Key structural features that can be targeted include:

  • The Central Pore: The cylindrical pore formed by the homopentameric assembly represents a potential binding site for small-molecule inhibitors. Compounds that occlude this pore could block zinc efflux.

  • Subunit Interfaces: The contact regions between monomers in the pentameric assembly are often critical for protein function. Molecules that disrupt these interfaces could prevent proper assembly and function.

  • Zinc Binding Sites: Identifying the specific residues involved in zinc coordination can guide the design of competitive inhibitors that mimic zinc but cannot be transported.

For experimental validation of potential inhibitors, researchers can employ:

  • In vitro transport assays with purified protein reconstituted in liposomes

  • Cellular zinc accumulation assays in the presence of inhibitors

  • Growth inhibition assays to assess biological relevance

  • Isothermal titration calorimetry to measure binding affinities

  • X-ray crystallography or cryo-EM to confirm binding modes

The unique structural features of ZntB, particularly its cylindrical pore configuration that differs from related transporters, offer opportunities for designing selective inhibitors that target ZntB without affecting host transporters .

What methodologies are most effective for studying the pentameric assembly of ZntB in membrane environments?

Studying the pentameric assembly of ZntB in membrane environments requires specialized techniques that preserve the native structure while providing detailed molecular information:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of membrane proteins in near-native states

    • Can achieve near-atomic resolution for large membrane protein complexes

    • Sample preparation involves reconstitution in nanodiscs or detergent micelles

    • Has the advantage of not requiring crystallization

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling can probe conformational changes during transport

    • DEER (Double Electron-Electron Resonance) measurements can determine distances between subunits

    • Provides dynamic information not available from static structures

  • Native Mass Spectrometry:

    • Can confirm the pentameric stoichiometry in detergent micelles

    • Allows testing of stability under different conditions

    • Can identify bound lipids or ions that stabilize the assembly

  • Molecular Dynamics Simulations:

    • Provide insights into dynamics of the pentamer in a lipid bilayer

    • Can predict conformational changes during transport

    • Validate and extend experimental structural data

  • Cross-linking Combined with Mass Spectrometry:

    • Identify residues in close proximity at subunit interfaces

    • Confirm assembly structure in native membranes

    • Map conformational changes in different functional states

These complementary approaches can overcome the limitations of X-ray crystallography, which provided the initial structural insights into ZntB cytoplasmic domains but may not fully capture the dynamics of the complete transporter in a membrane environment.

What purification strategies yield the highest activity for recombinant ZntB protein?

Purifying active recombinant ZntB protein requires careful consideration of expression conditions, detergent selection, and purification methodology. Based on successful approaches with similar membrane transporters, the following protocol is recommended:

  • Expression Optimization:

    • Use C41(DE3) or C43(DE3) E. coli strains specifically designed for membrane protein expression

    • Induce at lower temperatures (16-20°C) overnight to enhance proper folding

    • Consider co-expression with chaperones to improve yield of correctly folded protein

  • Membrane Extraction:

    • Extract membranes with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Include zinc (5-10 μM) in all buffers to stabilize the protein

    • Maintain pH between 7.0-8.0 in Tris or HEPES-based buffers

  • Purification Strategy:

Purification StepMethodBuffer ConditionsPurpose
Initial captureIMAC (Ni-NTA)20 mM Tris pH 8.0, 300 mM NaCl, 0.05% DDM, 5 μM ZnCl₂Utilize His-tag for initial purification
IntermediateSize exclusion20 mM Tris pH 7.5, 150 mM NaCl, 0.03% DDM, 5 μM ZnCl₂Remove aggregates, verify pentameric state
Optional polishIon exchange20 mM HEPES pH 7.0, 0.03% DDM, 5 μM ZnCl₂, 50-500 mM NaCl gradientFurther purify based on surface charge
  • Activity Verification:

    • Reconstitute purified protein into liposomes for transport assays

    • Use ⁶⁵Zn²⁺ efflux assays to confirm functional activity

    • Compare activity with known specific activity values from literature

  • Storage Considerations:

    • Store in buffer containing 10% glycerol for short-term or 50% glycerol for long-term

    • Maintain detergent above critical micelle concentration

    • Flash-freeze in liquid nitrogen and store at -80°C in small aliquots

This comprehensive approach typically yields protein with >90% purity and preserved transport activity.

How can researchers distinguish between the different zinc transport systems when studying ZntB function?

Distinguishing ZntB function from other zinc transporters in bacterial systems requires careful experimental design to isolate its specific contribution. Several methodological approaches can be employed:

  • Genetic Approach:

    • Create single and combinatorial knockout strains lacking specific transporters:

      • ΔzntB (ZntB efflux system)

      • ΔzntA (ZntA efflux system)

      • ΔzitB (ZitB efflux system)

      • ΔznuABC (ZnuABC uptake system)

      • ΔzupT (ZupT uptake system)

    • Complement these strains with plasmids expressing wild-type or mutated transporters

    • Example: Strain GR480 with mutations in zntA, zitB, zupD, znuABC, and yiiP was used to isolate ZntB function

  • Transport Specificity:

    • Compare transport of Zn²⁺ versus other divalent cations (Mg²⁺, Cd²⁺, Co²⁺)

    • ZntB shows significant activity for Zn²⁺ and some activity for Cd²⁺, but not for Mg²⁺, unlike CorA

    • Use disk diffusion assays with different metals to assess specificity profiles

  • Inhibitor Profiling:

    • Apply specific inhibitors of known transport systems:

      • Carbonyl cyanide m-chlorophenyl hydrazone (CCCP) - disrupts proton gradient

      • Vanadate - inhibits P-type ATPases like ZntA

      • EDTA or EGTA - chelate extracellular zinc

  • Expression Analysis:

    • Monitor expression of transport genes under different zinc conditions using qRT-PCR

    • ZntB expression patterns differ from other transporters, providing a temporal window to study its specific function

  • Transport Kinetics:

    • Measure transport rates at different zinc concentrations

    • Determine Km and Vmax values for different transporters

    • Each transporter has characteristic kinetic parameters that can serve as fingerprints

What are the most reliable methods for assessing ZntB-mediated zinc transport in vitro?

For reliable assessment of ZntB-mediated zinc transport in vitro, several complementary approaches can be employed:

  • Reconstituted Proteoliposome Assays:

    • Purified ZntB protein is reconstituted into phospholipid vesicles (liposomes)

    • Zinc transport can be measured by:

      • Radioactive ⁶⁵Zn²⁺ flux

      • Fluorescent zinc indicators trapped inside liposomes

      • Zinc-sensitive dyes that change color upon zinc binding

  • Solid Supported Membrane (SSM)-Based Electrophysiology:

    • ZntB is reconstituted into a planar lipid membrane

    • Charge movement during transport generates measurable currents

    • Allows real-time monitoring of transport activity

    • Can distinguish between different transport mechanisms

  • Isothermal Titration Calorimetry (ITC):

    • Measures heat changes associated with zinc binding to ZntB

    • Provides binding affinities and thermodynamic parameters

    • Can differentiate between transport-competent and transport-deficient variants

  • Microscale Thermophoresis (MST):

    • Detects changes in thermophoretic mobility upon zinc binding

    • Requires small amounts of protein

    • Works well with membrane proteins in detergent solutions

Experimental Protocol for Proteoliposome Transport Assay:

StepProcedureParametersNotes
1Protein reconstitutionProtein:lipid ratio 1:100 to 1:200Use E. coli polar lipid extract
2Liposome sizingExtrude through 400 nm filtersEnsures uniform vesicle size
3Buffer exchangeRemove external zincUse gel filtration or dialysis
4Transport initiationAdd external zinc (1-100 μM)Include positive/negative controls
5Sample collectionTime points: 0, 1, 2, 5, 10, 20 minMaintain constant temperature
6Transport quantificationMeasure zinc contentUse AAS or ICP-MS for high sensitivity

By combining these approaches, researchers can obtain comprehensive insights into the kinetics, energetics, and mechanism of ZntB-mediated zinc transport under controlled conditions .

How can structural insights from ZntB inform the understanding of related human zinc transporters?

The structural and functional characterization of bacterial ZntB provides valuable insights that can be extrapolated to human zinc transporters, despite limited sequence homology:

  • Transport Mechanism Insights:

    • The pentameric assembly of ZntB with its central pore suggests a channel-like mechanism for zinc transport

    • This differs from the alternating access mechanism proposed for human ZnT transporters

    • Comparing these mechanisms can reveal evolutionary diversity in zinc transport solutions

  • Structure-Function Relationships:

    • The cylindrical pore observed in StZntB crystal structures suggests an "open" conformation

    • This provides a structural template for modeling conformational changes during transport

    • Similar conformational changes might exist in human transporters

  • Metal Selectivity Determinants:

    • ZntB shows specificity for zinc and cadmium over magnesium despite structural similarity to CorA

    • Identifying the residues responsible for this selectivity can inform studies of selectivity in human transporters

    • Comparative analysis of binding sites can reveal conserved features

  • Regulatory Mechanisms:

    • Understanding how bacterial systems regulate ZntB expression and activity in response to zinc levels

    • May provide paradigms for understanding regulation of human zinc transporters

    • Could inform therapeutic approaches for zinc-related disorders

A practical research approach would involve:

  • Creating chimeric proteins combining domains from bacterial and human transporters

  • Using site-directed mutagenesis to introduce human-specific residues into bacterial transporters

  • Developing computational models of human transporters based on bacterial structures

  • Testing predictions with functional assays in relevant cell types

These comparative studies could particularly benefit research on human ZnT family transporters, which are involved in numerous pathological conditions including diabetes, Alzheimer's disease, and certain cancers.

What role might ZntB play in Salmonella virulence and host-pathogen interactions?

ZntB likely plays a significant role in Salmonella virulence and host-pathogen interactions through its function in zinc homeostasis during infection:

  • Zinc Warfare at the Host-Pathogen Interface:

    • Host cells employ "nutritional immunity" by sequestering zinc to limit bacterial growth

    • Macrophages can also release toxic levels of zinc into phagosomes containing bacteria

    • ZntB-mediated zinc efflux may protect Salmonella from zinc toxicity in the phagosome

  • Survival in Zinc-Limited Environments:

    • While ZntB primarily functions in zinc efflux, the integrated zinc homeostasis network (including ZntB) enables adaptation to varying zinc conditions

    • This adaptability is crucial for colonization of different host niches

  • Experimental Evidence and Future Directions:

Research ApproachMethodologyExpected OutcomesApplication to Virulence Studies
In vivo infection modelsCompare virulence of wild-type vs. ΔzntB SalmonellaQuantify colonization, dissemination, and survival differencesDetermine importance in specific infection stages
Macrophage infection assaysFluorescence microscopy with zinc-sensitive probesVisualize zinc dynamics during infectionUnderstand zinc trafficking in host cells
TranscriptomicsRNA-seq of bacteria during infectionIdentify co-regulated virulence factorsPlace ZntB in virulence regulatory networks
Immune response analysisCytokine profilingDetermine if zinc homeostasis affects immune responseConnect to host defense mechanisms
  • Therapeutic Implications:

    • ZntB inhibitors could potentially sensitize Salmonella to zinc toxicity

    • Combination therapies targeting zinc homeostasis might enhance antibiotic efficacy

    • Understanding the structure of ZntB could facilitate rational drug design

Future research should focus on determining the precise zinc concentrations encountered by Salmonella during different stages of infection and how ZntB activity modulates bacterial responses to these changing conditions. The unique structural features of ZntB, particularly its cylindrical pore configuration , may provide opportunities for selective targeting in antimicrobial development.

How can CRISPR-Cas9 technology be applied to study ZntB function and regulation?

CRISPR-Cas9 technology offers powerful approaches for investigating ZntB function and regulation in Salmonella and related bacteria:

  • Precise Genetic Manipulation:

    • Generate clean knockout mutants without antibiotic resistance markers

    • Create point mutations to investigate specific residues identified in crystal structures

    • Introduce reporter fusions at the native locus to study expression patterns

  • Multiplexed Gene Editing:

    • Simultaneously edit multiple zinc transport genes (zntB, zntA, zitB, znuABC)

    • Create combinatorial mutants to dissect functional redundancy

    • Generate strains with humanized versions of transport proteins

  • CRISPRi (CRISPR Interference) Applications:

    • Achieve tunable repression of zntB expression using dCas9

    • Study dosage effects on zinc homeostasis

    • Temporally control zntB expression during infection experiments

  • CRISPRa (CRISPR Activation) Approaches:

    • Upregulate zntB expression to study effects of overexpression

    • Identify potential negative effects of dysregulated zinc efflux

    • Test for dominance effects in multi-transporter backgrounds

  • Genome-Wide Screens:

    • Identify genetic interactions with zntB using CRISPR screens

    • Discover new components of zinc homeostasis networks

    • Map synthetic lethal interactions that could inform antimicrobial development

Experimental Design Example:

CRISPR ApplicationTargetMethodologyExpected OutcomeAnalysis Approach
Base editingConserved residues in pore regionCreate point mutations without double-strand breaksStructure-function correlationTransport assays combined with structural analysis
CRISPRizntB promoterTitrate dCas9 expressionDose-dependent phenotypesGrowth curves in varying zinc concentrations
Multiplexed KOAll zinc transportersMultiple gRNAsComprehensive zinc transport modelSystems biology analysis of zinc fluxes
CRISPR screeningGenome-widegRNA library, zinc selectionNew zinc homeostasis factorsNetwork analysis of hits

These CRISPR-based approaches offer unprecedented precision in manipulating ZntB and related systems, enabling researchers to address questions that were previously challenging with traditional genetic methods.

What are the most promising approaches for developing antimicrobials targeting bacterial zinc transport systems like ZntB?

Targeting bacterial zinc transport systems like ZntB represents a promising avenue for antimicrobial development, with several strategic approaches:

  • Structure-Based Drug Design:

    • Utilize the high-resolution crystal structures of ZntB cytoplasmic domains

    • Target the unique cylindrical pore configuration of the pentameric assembly

    • Design molecules that block the channel without affecting human zinc transporters

    • In silico screening followed by biochemical validation can identify lead compounds

  • Allosteric Inhibitors:

    • Target sites at subunit interfaces rather than the central pore

    • Disrupt conformational changes required for transport

    • May offer higher selectivity than active site inhibitors

    • Combine computational docking with fragment-based screening approaches

  • Zinc Mimetics:

    • Develop compounds that mimic zinc but cannot be transported

    • Create competitive inhibitors of zinc binding sites

    • Design zinc-binding molecules that irreversibly modify the transporter

  • Combination Approaches:

    • Target multiple zinc transporters simultaneously (ZntA, ZntB, ZitB)

    • Combine zinc transport inhibitors with conventional antibiotics

    • Exploit synergistic effects by disrupting zinc homeostasis and other cellular processes

  • Experimental Validation Pipeline:

StageMethodologyKey MetricsDecision Criteria
Primary screeningIn vitro transport assaysIC₅₀ for transport inhibition<10 μM IC₅₀
Secondary screeningBacterial growth inhibitionMIC in wild-type vs. ΔzntB>4-fold selectivity
Mechanism validationLiposome flux assays, ITCBinding constants, transport kineticsConfirms mode of action
Specificity testingHuman cell toxicityTherapeutic index>50-fold selectivity
In vivo efficacyAnimal infection modelsReduction in bacterial burdenStatistically significant reduction

The potential advantages of targeting zinc transport systems include:

  • Novel mechanism of action distinct from current antibiotics

  • Potential effectiveness against antibiotic-resistant strains

  • Possible narrow-spectrum activity limiting disruption of the microbiome

  • Opportunities for rational design based on structural insights

This approach represents a paradigm shift from traditional antibiotic targets and could yield valuable additions to our antimicrobial arsenal.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.