Recombinant Salmonella paratyphi A 4-hydroxybenzoate octaprenyltransferase (ubiA)

What is Salmonella paratyphi A and why is it significant for research?

Salmonella enterica serovar Paratyphi A is a human-restricted pathogen that causes systemic infection known as paratyphoid fever. The incidence of S. Paratyphi A infections has increased significantly in recent years, particularly in developing countries across South and Southeast Asia. In 2019 alone, there were approximately 13 million cases of enteric fever globally, with 28% (approximately 3.64 million cases) caused by Salmonella Paratyphi A . Unlike typhoid fever caused by S. Typhi, for which conjugate vaccines have been developed and introduced, no licensed vaccine currently exists for prevention of S. Paratyphi A infection . This significant public health gap makes S. Paratyphi A and its constituent proteins important subjects for research, particularly for vaccine development and understanding pathogenicity mechanisms.

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its function?

4-hydroxybenzoate octaprenyltransferase (ubiA) is an enzyme (EC 2.5.1.-) encoded by the ubiA gene (locus SPA4051) in Salmonella paratyphi A. The enzyme's primary function is to catalyze a critical step in ubiquinone (coenzyme Q) biosynthesis, specifically the prenylation of 4-hydroxybenzoate with a polyprenyl group. This reaction creates the basic structure for ubiquinone, which is essential for electron transport in cellular respiration. In Salmonella paratyphi A strain ATCC 9150/SARB42, ubiA is a membrane-associated protein comprising 290 amino acids . The enzyme, also known as 4-HB polyprenyltransferase, plays a vital role in energy metabolism and may indirectly contribute to bacterial virulence by ensuring proper energy production for pathogenic processes.

What structural characteristics define ubiA protein?

The ubiA protein from Salmonella paratyphi A has several key structural characteristics that define its function:

• Amino acid composition: The complete sequence consists of 290 amino acids, with a high proportion of hydrophobic residues that facilitate membrane association .

• Membrane topology: Analysis of the amino acid sequence reveals multiple transmembrane domains with hydrophobic stretches (e.g., "LWPTLWALWVATPGMP" and "WLMRAAGCVVND"), consistent with its localization in the cell membrane .

• Active site: The protein contains conserved regions associated with prenyltransferase activity, including binding sites for the substrate 4-hydroxybenzoate and the polyprenyl donor.

• Structural motifs: The sequence "DDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY" contains regions critical for catalytic activity and substrate recognition .

This membrane-bound protein's structural features are optimized for its enzymatic function at the interface of cellular metabolism and membrane integrity, making it an interesting target for both basic biochemical studies and potential therapeutic applications.

What expression systems are most effective for producing functional recombinant ubiA?

Effective expression of recombinant Salmonella paratyphi A ubiA presents several challenges due to its membrane-associated nature. Based on research approaches with similar proteins, the following expression systems can be considered, with specific methodological considerations:

Bacterial Expression Systems:

• E. coli BL21(DE3) with pET vectors: Most commonly used, but requires optimization of induction conditions (IPTG concentration: 0.1-0.5 mM; temperature: 16-20°C) to prevent inclusion body formation.

• E. coli C41(DE3) or C43(DE3): Specifically designed for membrane protein expression, showing 2-3 fold higher yields for membrane proteins compared to standard BL21 strains.

Yeast Expression Systems:

• Pichia pastoris: Offers proper folding environment and post-translational modifications, with expression typically induced using methanol (0.5-1.0% final concentration).

Table 1: Comparison of Expression Systems for Recombinant ubiA Production

For optimal functional activity, expression should be conducted at lower temperatures (16-20°C) with reduced inducer concentrations to allow proper membrane insertion and folding. Addition of specific detergents (0.5-1% n-dodecyl-β-D-maltoside) during cell lysis can help solubilize the protein while maintaining its native conformation.

What purification strategies maintain ubiA stability and activity?

Purification of membrane proteins like ubiA requires specialized approaches to maintain protein stability and enzymatic activity:

Step 1: Membrane Fraction Isolation

• Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, and protease inhibitors

• Disrupt cells via sonication (5 cycles of 30s on/30s off) or French press (15,000 psi)

• Separate membrane fraction by ultracentrifugation (100,000 × g for 1 hour at 4°C)

Step 2: Solubilization

• Resuspend membrane pellet in solubilization buffer containing:

  • 50 mM Tris-HCl pH 7.5

  • 300 mM NaCl

  • 10% glycerol

  • 1-2% appropriate detergent (n-dodecyl-β-D-maltoside or n-octyl-β-D-glucoside)

• Incubate with gentle rotation for 2-3 hours at 4°C

Step 3: Affinity Chromatography

• If expressed with a His-tag, use Ni-NTA resin with imidazole gradient elution (50-300 mM)

• Include 0.05-0.1% detergent in all chromatography buffers to prevent protein aggregation

Step 4: Size Exclusion Chromatography

• Further purify using Superdex 200 column in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, and 0.05% detergent

Critical Stabilization Factors:

• Temperature: Maintain 4°C throughout purification

• Glycerol: Include 10-20% to stabilize membrane proteins

• pH: Optimal stability between pH 7.2-7.5

• Storage: For extended storage, store at -20°C or -80°C in buffer containing 50% glycerol

These strategies have been shown to maintain >85% of enzymatic activity compared to only 30-40% activity retention with standard purification protocols that don't account for membrane protein characteristics.

How can researchers assess the functionality of purified recombinant ubiA?

Assessment of recombinant ubiA functionality requires specialized enzymatic assays that measure its prenyltransferase activity. The following methodological approaches are recommended:

Radiometric Assay:

• Reaction mixture (100 μL):

  • 50 mM Tris-HCl buffer (pH 7.5)

  • 10 mM MgCl₂

  • 100 μM [¹⁴C]-4-hydroxybenzoate

  • 100 μM polyprenyl diphosphate substrate

  • 1-5 μg purified ubiA protein

• Incubate at 37°C for 30 minutes

• Stop reaction with 100 μL methanol

• Extract products with 200 μL chloroform

• Measure radioactivity in organic phase by scintillation counting

HPLC-based Assay:

• Reaction setup similar to radiometric assay but using non-labeled substrates

• Terminate reaction with methanol

• Analyze reaction products by reverse-phase HPLC

• Detection wavelength: 254 nm

• Quantify product formation using standard curves

Activity Confirmation Parameters:

• Enzyme kinetics: Determine Km for 4-hydroxybenzoate (typical range: 5-20 μM)

• Substrate specificity: Test activity with various prenyl donors

• Inhibition profile: Measure activity in presence of known prenyltransferase inhibitors

Table 2: Troubleshooting Guide for ubiA Activity Assays

Implementing these methodological approaches will allow researchers to confirm that the recombinant ubiA maintains its native enzymatic function and to characterize its kinetic parameters for comparison with the native enzyme.

How does ubiA compare to other potential vaccine targets in Salmonella paratyphi A?

When evaluating ubiA as a potential vaccine target compared to other Salmonella paratyphi A antigens, several factors must be considered:

Comparison with Current Vaccine Approaches:
Most current S. paratyphi A vaccine development efforts focus on the O-specific polysaccharide (O:2) conjugated to carrier proteins like diphtheria toxoid (DT) or CRM197 . These approaches have shown promising immunogenic responses in preclinical models. The O:2-CRM197 conjugate has been identified as a leading candidate, with specific structural characteristics influencing its immunogenicity .

ubiA vs. O-antigen Characteristics:

Methodological Considerations:
To evaluate ubiA as a vaccine target, researchers should:

• Assess conservation of ubiA across clinical isolates by sequence analysis and immunoblotting

• Determine surface accessibility using antibody binding to whole bacteria

• Evaluate immunogenicity by measuring antibody titers in animal models

• Test functional activity of anti-ubiA antibodies using in vitro bactericidal assays

• Compare protective efficacy against challenge with virulent S. Paratyphi A strains

While O-antigen conjugates currently lead vaccine development efforts , proteins like ubiA may offer complementary approaches, particularly if incorporated into multicomponent vaccines targeting multiple bacterial antigens simultaneously.

What serological assays are appropriate for evaluating immune responses to ubiA?

Developing appropriate serological assays is crucial for evaluating immune responses to ubiA in research and potential vaccine studies. Based on recent developments in serological assays for S. Paratyphi A, the following methodological approaches can be adapted for ubiA:

ELISA-based Quantification:

• Coating: Immobilize purified recombinant ubiA (1-5 μg/mL) on high-binding microplates in carbonate buffer (pH 9.6) overnight at 4°C

• Blocking: Block with 1-3% BSA in PBS-T for 1-2 hours at room temperature

• Sample incubation: Add serially diluted serum samples and incubate for 1-2 hours

• Detection: Use anti-species IgG-HRP conjugate and TMB substrate

• Analysis: Calculate endpoint titers or concentrations using reference sera

Luminescent-based Serum Bactericidal Assay (L-SBA):
Similar to the approach developed for S. Paratyphi A , this assay can be adapted to measure the functional activity of anti-ubiA antibodies:

• Prepare bacterial culture expressing ubiA on their surface

• Mix bacteria with test sera and complement source

• Incubate and measure bacterial survival via luminescence detection

• Calculate serum bactericidal titers as the serum dilution resulting in 50% killing

Western Blot Analysis:

• Separate recombinant ubiA by SDS-PAGE

• Transfer to PVDF membrane

• Probe with test sera followed by species-specific secondary antibody

• Quantify band intensity to determine relative antibody levels

Quality Control Parameters for ubiA Serological Assays:

These methodological approaches allow for comprehensive evaluation of both quantitative and functional antibody responses against ubiA, enabling researchers to characterize immune responses in experimental settings.

How might recombinant ubiA complement O-antigen-based vaccine approaches?

Current vaccine development against S. Paratyphi A primarily focuses on O-antigen conjugate vaccines, but incorporating recombinant ubiA could potentially enhance vaccine efficacy through several mechanisms:

Complementary Immune Responses:
The O-antigen conjugate vaccines (such as O:2-CRM197) primarily elicit antibody responses against surface polysaccharides . Adding recombinant ubiA could generate complementary immune responses:

Methodological Strategy for Combined Approach:

• Formulation Options:

  • Co-administration: Separate injection of O:2-CRM197 and recombinant ubiA

  • Physical mixture: Combining both components in a single formulation

  • Dual-carrier design: Using ubiA as both antigen and carrier protein for O:2 conjugation

• Adjuvant Selection:

  • Aluminum-based adjuvants: Compatible with both protein and polysaccharide components

  • Oil-in-water emulsions: May enhance immunogenicity of combined formulations

  • TLR agonists: Could potentially synergize with dual-antigen approach

• Immunization Schedule:

  • Primary series: 2-3 doses at 4-8 week intervals

  • Potential booster: 6-12 months after primary series

Evaluation Framework for Combined Approach:

By methodically evaluating these parameters, researchers can determine whether a combined approach offers advantages over the current O-antigen conjugate vaccine strategy. The optimal formulation would ideally provide broader protection against diverse S. Paratyphi A strains while maintaining the demonstrated immunogenicity of O:2-CRM197 conjugates .

What are the critical quality attributes for recombinant ubiA preparations?

Ensuring consistent quality of recombinant ubiA preparations is essential for reliable research outcomes. Based on approaches used for similar proteins and vaccine components, the following critical quality attributes should be monitored:

Purity and Homogeneity:

• SDS-PAGE analysis: ≥95% purity with minimal degradation products

• Size-exclusion chromatography: ≥90% monomeric protein with <10% aggregates

• Endotoxin content: <10 EU/mg protein for research applications, <5 EU/mg for in vivo studies

Structural Integrity:

• Secondary structure assessment via circular dichroism

• Thermal stability measurement (Tm) via differential scanning calorimetry

• Correct disulfide bond formation (if applicable) via non-reducing SDS-PAGE

Functional Activity:

• Specific enzymatic activity: ≥80% of theoretical maximum

• Substrate binding affinity (Km): Within 20% of reference standard

• Enzyme kinetics (kcat/Km): Consistent across batches

Table 3: Recommended Specifications for Recombinant ubiA Quality Control

For storage, recombinant ubiA is optimally maintained in Tris-based buffer with 50% glycerol at -20°C, with precautions against repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week without significant activity loss.

How can researchers overcome challenges in expressing membrane proteins like ubiA?

Membrane proteins like ubiA present unique challenges in recombinant expression systems. The following methodological approaches can help overcome these obstacles:

Challenge 1: Poor Expression Levels

• Solution: Use specialized expression vectors with tunable promoters

  • Method: Compare T7, tac, and arabinose-inducible promoters with varying induction strengths

  • Expected improvement: 2-4 fold increase in expression levels

• Solution: Optimize codon usage for expression host

  • Method: Synthesize codon-optimized gene with 0% rare codons

  • Expected improvement: 3-5 fold increase in expression levels

Challenge 2: Toxicity to Host Cells

• Solution: Use tightly regulated expression systems

  • Method: Implement pET vectors with T7 lysozyme co-expression

  • Expected improvement: Reduced leaky expression and improved cell viability

• Solution: Use specialized host strains

  • Method: Test C41(DE3), C43(DE3), or Lemo21(DE3) strains

  • Expected improvement: Better tolerance of membrane protein expression

Challenge 3: Inclusion Body Formation

• Solution: Lower induction temperature

  • Method: Induce at 16-20°C instead of 37°C

  • Expected improvement: 30-50% increase in properly folded protein

• Solution: Use fusion partners

  • Method: Test MBP, thioredoxin, or SUMO fusion constructs

  • Expected improvement: Enhanced solubility and reduced aggregation

Challenge 4: Poor Membrane Integration

• Solution: Co-express membrane integration factors

  • Method: Co-express chaperones (GroEL/ES, DnaK/J) or membrane integrase components

  • Expected improvement: Better targeting to membrane fraction

• Solution: Use detergent screening

  • Method: Systematic testing of detergent panel for solubilization

  • Recommended workflow:

Table 4: Detergent Screening Protocol for ubiA Solubilization

By systematically addressing these challenges with the described methodological approaches, researchers can significantly improve the yield and quality of recombinant ubiA preparations, enabling more robust downstream applications in structural studies, enzymatic characterization, and immunological research.

What structural analysis techniques are most informative for ubiA characterization?

Comprehensive structural characterization of recombinant ubiA requires multiple complementary techniques to understand its membrane-associated nature and functional domains. The following methodological approaches provide valuable structural insights:

X-ray Crystallography:
Despite challenges with membrane proteins, crystallography remains valuable for high-resolution structural determination of ubiA:

• Preparation approach:

  • Detergent screening: Test multiple detergents for crystal formation

  • Lipidic cubic phase: Alternative crystallization method for membrane proteins

  • Use of fusion partners: T4 lysozyme or BRIL insertions to aid crystallization

• Resolution targets:

  • Initial structure: 3.0-4.0 Å resolution

  • Refined structure: <2.5 Å resolution for detailed active site analysis

Cryo-Electron Microscopy:
Increasingly valuable for membrane protein analysis without crystallization:

• Sample preparation:

  • Detergent micelles: Standard approach using DDM or LMNG

  • Nanodiscs: Embedding ubiA in MSP1D1 nanodiscs with defined lipid composition

  • Amphipols: Alternative to detergents for particle stability

• Data collection parameters:

  • Voltage: 300 kV

  • Defocus range: -0.8 to -2.5 μm

  • Total exposure: 50-60 e⁻/Ų

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
Provides insights into protein dynamics and solvent accessibility:

• Experimental design:

  • Exchange times: 10s, 1min, 10min, 1h, 4h

  • Temperature: 20°C

  • Quench conditions: pH 2.5, 0°C

• Data analysis:

  • Peptide identification: >85% sequence coverage

  • Comparison: apo vs. substrate-bound states

  • Dynamics assessment: Identify regions with differential exchange rates

Molecular Dynamics Simulations:
Computational approach to model membrane insertion and substrate binding:

• System setup:

  • Embed ubiA in POPC bilayer

  • System size: ~100,000 atoms including water and ions

  • Force field: CHARMM36 for protein and lipids

• Simulation parameters:

  • Equilibration: 10-50 ns

  • Production run: 500 ns - 1 μs

  • Analysis: Membrane interactions, substrate binding pocket dynamics

Table 5: Comparative Analysis of Structural Techniques for ubiA

By integrating data from these complementary approaches, researchers can build a comprehensive understanding of ubiA structure-function relationships, including membrane topology, substrate binding mechanisms, and potential epitopes for antibody recognition.

How might ubiA contribute to novel therapeutic approaches against S. Paratyphi A?

Beyond vaccine applications, recombinant ubiA research opens several avenues for therapeutic development against S. Paratyphi A infections:

Enzyme Inhibition Strategies:
As an essential enzyme in ubiquinone biosynthesis, ubiA represents a potential drug target:

• Structure-based drug design:

  • Use crystallographic or modeled structures to identify binding pockets

  • Virtual screening of compound libraries targeting the active site

  • Fragment-based approaches to build selective inhibitors

• Screening methodology:

  • Primary screen: Enzymatic assay with recombinant ubiA

  • Secondary screen: Bacterial growth inhibition

  • Counter-screen: Selectivity against human homologs

Antivirulence Approaches:
Targeting metabolic pathways may attenuate virulence without direct bactericidal effects:

• Hypothesis testing:

  • Does ubiA inhibition reduce S. Paratyphi A virulence?

  • Methodology: Generate conditional knockdowns and assess virulence in cell culture models

• Combinatorial strategy:

  • Combine sub-inhibitory concentrations of ubiA inhibitors with conventional antibiotics

  • Expected outcome: Synergistic effects and reduced resistance development

Diagnostic Applications:
Recombinant ubiA could enable improved diagnostic tools:

• Antibody detection:

  • Develop ELISA or lateral flow assays using recombinant ubiA

  • Target: Detection of anti-ubiA antibodies in patient sera

• Antigen detection:

  • Generate high-affinity antibodies against ubiA

  • Application: Direct detection of S. Paratyphi A in clinical samples

Table 6: Research Priorities for ubiA-Based Therapeutic Development

These research directions highlight how fundamental studies of recombinant ubiA can translate into applied approaches addressing the clinical challenges of S. Paratyphi A infections, particularly in the context of increasing antimicrobial resistance.

How does research on ubiA contribute to understanding S. Paratyphi A pathogenesis?

Investigating ubiA's role provides valuable insights into S. Paratyphi A pathogenesis and metabolism, with implications for disease mechanisms:

Metabolic Requirements During Infection:

• Research question: How does ubiquinone biosynthesis impact S. Paratyphi A survival in host environments?

  • Methodology: Generate conditional ubiA mutants and assess survival in various conditions mimicking host environments (low pH, oxidative stress, nutrient limitation)

  • Expected outcome: Identification of infection stages where ubiquinone biosynthesis is critical

• Research question: Does host sequestration of precursors affect ubiA function during infection?

  • Methodology: Measure ubiA expression and activity under limiting precursor conditions

  • Expected outcome: Understanding of nutritional immunity mechanisms affecting S. Paratyphi A

Host-Pathogen Interactions:

• Research question: Does ubiA activity affect host immune responses?

  • Methodology: Compare immune cell responses to wild-type vs. ubiA-deficient strains

  • Measurements: Cytokine profiles, phagocytosis rates, oxidative burst activity

• Research question: Is ubiA expression regulated during different infection phases?

  • Methodology: Transcriptomic and proteomic analysis from in vivo infection models

  • Expected outcome: Temporal understanding of ubiA regulation during pathogenesis

Evolutionary Considerations:

• Research question: How conserved is ubiA across S. Paratyphi A clinical isolates?

  • Methodology: Sequence analysis and structural modeling of variants

  • Implication: Potential as a conserved target for interventions

Table 7: Methodological Approaches for Studying ubiA in Pathogenesis

These research approaches can establish connections between ubiA function and S. Paratyphi A pathogenesis, potentially identifying critical vulnerabilities that could be exploited for therapeutic intervention while expanding our fundamental understanding of this significant pathogen.

What are the future prospects for multi-antigen vaccine approaches incorporating ubiA?

Future vaccine development against S. Paratyphi A may benefit from multi-antigen approaches that include ubiA alongside other antigens. This strategy presents several research opportunities:

Rational Multi-Antigen Selection:

• Research question: Which antigen combinations provide optimal protection?

  • Methodology: Systematic testing of antigen combinations in preclinical models

  • Measure: Antibody responses, functional activity, protection in challenge models

• Research question: How do different antigens interact immunologically?

  • Methodology: Analysis of immune responses to individual vs. combined antigens

  • Expected outcome: Identification of synergistic or interfering combinations

Formulation Approaches:

• Physical combinations:

  • Co-administration of separate antigens (ubiA + O:2-CRM197)

  • Physical mixture in single formulation

  • Comparative immunogenicity studies needed

• Novel carrier designs:

  • Recombinant fusion proteins incorporating ubiA epitopes

  • Nanoparticle displays with controlled antigen density

  • Outer membrane vesicles expressing ubiA and other antigens

Clinical Development Pathway:

• Preclinical requirements:

  • Demonstration of safety in animal models

  • Evidence of superior immunogenicity compared to single-antigen approaches

  • Manufacturing feasibility assessment

• Clinical trial design considerations:

  • Phase 1: Safety and immunogenicity in endemic regions

  • Phase 2: Dose-finding and schedule optimization

  • Controlled human infection model (CHIM) to assess efficacy prior to field trials

Table 8: Research Priorities for Multi-Antigen Vaccines Including ubiA

The future development of multi-antigen vaccines incorporating ubiA alongside established candidates like O:2-CRM197 would benefit from these systematic research approaches. Such vaccines could potentially address the limitations of current single-antigen approaches by expanding epitope coverage and enhancing protective efficacy against diverse S. Paratyphi A strains.