Recombinant Salmonella paratyphi A ATP synthase subunit a (atpB)

What is ATP synthase subunit a (atpB) in Salmonella paratyphi A and what is its function?

ATP synthase subunit a, encoded by the atpB gene in Salmonella paratyphi A, is a critical component of the F0 sector of the bacterial ATP synthase complex (also known as F-ATPase). This 271-amino acid membrane protein forms part of the proton channel that spans the bacterial cell membrane . The protein functions as a key component in the rotary mechanism of ATP synthesis, facilitating the flow of protons across the membrane which drives the conformational changes necessary for ATP production .

The protein's amino acid sequence reveals its hydrophobic nature, consistent with its role as a membrane-embedded protein with multiple transmembrane segments that form the proton channel structure . Understanding this protein's structure-function relationship provides insights into bacterial bioenergetics and potentially reveals targets for antimicrobial development.

How should recombinant atpB protein be stored and handled to maintain optimal activity?

Proper storage and handling of recombinant Salmonella paratyphi A ATP synthase subunit a (atpB) is critical for maintaining protein integrity and functionality in experimental applications. The protein is typically supplied as a lyophilized powder, which provides stability during shipping and long-term storage . Upon receipt, the protein should be stored at -20°C to -80°C, with the latter temperature preferred for extended storage periods .

For optimal handling, aliquoting the reconstituted protein is necessary to avoid repeated freeze-thaw cycles, which can significantly compromise protein structure and function . Working aliquots can be maintained at 4°C for up to one week, but longer-term storage requires freezing conditions . The reconstitution process should begin with a brief centrifugation of the vial to ensure the lyophilized product is at the bottom before opening, followed by dissolution in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL .

For long-term storage stability, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) before aliquoting and freezing . The glycerol serves as a cryoprotectant, preventing ice crystal formation that could denature the protein. The storage buffer typically consists of a Tris/PBS-based solution with 6% Trehalose at pH 8.0, which helps maintain protein stability . Researchers should document the reconstitution date and storage conditions for each aliquot to ensure reliable experimental results.

What expression systems are used for producing recombinant Salmonella paratyphi A atpB protein?

Recombinant Salmonella paratyphi A ATP synthase subunit a (atpB) is predominantly expressed using E. coli as the host organism due to its well-characterized genetics, rapid growth, and high protein yield capabilities . The expression system typically utilizes a plasmid vector containing the atpB gene sequence (encoding amino acids 1-271) fused to an N-terminal histidine tag to facilitate purification . This His-tag fusion approach allows for efficient one-step purification using immobilized metal affinity chromatography (IMAC).

For optimal expression, induction conditions must be carefully controlled, including temperature (typically lowered to 16-25°C during induction to improve proper folding), inducer concentration, and induction duration . The expression system design must account for the hydrophobic nature of this membrane protein, often incorporating solubility-enhancing fusion partners or adjusting growth conditions to promote proper membrane integration. Following expression, the protein is typically extracted using detergents that solubilize membrane proteins while maintaining their native-like structure before purification via the His-tag .

What analytical methods are most effective for confirming the identity and purity of recombinant atpB?

Multiple analytical methods can be employed to confirm the identity and purity of recombinant Salmonella paratyphi A ATP synthase subunit a (atpB), with SDS-PAGE being the primary technique for purity assessment . For research-grade applications, a purity level greater than 90% as determined by SDS-PAGE is generally considered acceptable . The protein typically appears as a band corresponding to approximately 30 kDa, though the exact migration pattern may be influenced by the presence of the His-tag and the hydrophobic nature of this membrane protein.

Beyond SDS-PAGE, western blotting using antibodies specific to either the His-tag or the atpB protein provides confirmation of protein identity. Mass spectrometry approaches, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS) following tryptic digestion, offer the most definitive identification by matching peptide fragments to the known sequence of the protein (MASENMTPQEYIGHHLNNLQLDLRTFSLVDPQNPPATFWTLNIDSMFFSVVLGLLFLVMFRSVAKKATSGVPGKFQTAIELIVGFVHGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHWLGLPATRVVPSADVNITLSMALGVFILILFYSIKMKGIGGFAKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH) .

For functional verification, researchers can employ activity assays that evaluate the protein's ability to participate in ATP synthesis or hydrolysis. While traditional activity assays may be challenging for the isolated subunit a, reconstitution into proteoliposomes or nanodiscs followed by proton translocation measurements can provide functional confirmation. Additionally, circular dichroism (CD) spectroscopy can be used to verify the secondary structure composition expected for this alpha-helix-rich membrane protein, providing evidence of proper folding.

How can researchers effectively reconstruct functional ATP synthase complexes using recombinant atpB?

Reconstructing functional ATP synthase complexes incorporating recombinant Salmonella paratyphi A atpB requires careful consideration of membrane protein reconstitution techniques. The process begins with purifying all necessary subunits of the F0 and F1 sectors, with special attention to maintaining the native-like conformation of the hydrophobic atpB component . Researchers typically employ a stepwise assembly approach, first reconstituting the membrane-embedded F0 sector (containing atpB) into a suitable membrane mimetic system before adding the water-soluble F1 components.

Several membrane mimetic systems have proven effective for ATP synthase reconstitution. Proteoliposomes prepared from phospholipids (typically a mixture resembling bacterial membrane composition) provide an environment that allows for functional assessment of proton translocation and ATP synthesis/hydrolysis . Nanodiscs, consisting of a phospholipid bilayer surrounded by membrane scaffold proteins, offer a more controlled size and composition, facilitating biophysical studies of the complex. Polymer-based systems such as styrene-maleic acid lipid particles (SMALPs) can extract membrane proteins with their native lipid environment intact, preserving functional interactions.

The functional assessment of reconstituted complexes typically employs assays measuring ATP synthesis driven by an artificially imposed proton gradient or ATP hydrolysis accompanied by proton pumping . A novel approach developed to quantify the proportion of ATP synthase working in forward versus reverse directions utilizes the Seahorse XF96 Analyzer to simultaneously measure oxygen consumption (indicating ATP synthesis) and pH changes from proton release (indicating ATP hydrolysis) . This methodology provides valuable insights into the bidirectional functionality of ATP synthase under different physiological conditions, with applications in understanding bacterial energy metabolism during stress conditions.

What are the experimental approaches for studying atpB's role in ATP synthase reverse activity during cellular stress?

ATP synthase can operate bidirectionally, synthesizing ATP under normal conditions but potentially reversing to hydrolyze ATP and generate a proton gradient during certain stress conditions. Studying the reverse activity of ATP synthase with focus on the atpB component requires specialized experimental setups that can distinguish between the synthetic and hydrolytic functions of the complex .

A cutting-edge approach for investigating this phenomenon employs the Seahorse XF96 Analyzer, which can simultaneously measure oxygen consumption (linked to ATP synthesis) and proton production (linked to ATP hydrolysis) in the same sample . This technique relies on the fact that during ATP hydrolysis, one proton is net transported per 2.67 molecules of ATP hydrolyzed, leading to measurable acidification rates . With isolated mitochondria or bacterial membrane vesicles containing ATP synthase, researchers can attribute pH changes specifically to ATP synthase activity rather than other cellular processes like glycolysis .

The experimental protocol typically involves preparing coupled membrane vesicles containing the ATP synthase complex with incorporated recombinant atpB, then measuring State 3 respiration (oxygen consumption induced by saturating ADP concentrations) concurrently with acidification rates . Inhibitors specific to different components of the ATP synthase can be used to dissect the contribution of atpB to the reverse activity. For instance, researchers have found that (+)-Epichatechin can inhibit the hydrolytic activity of ATP synthase without affecting its synthesis function, making it a valuable tool for these investigations .

Through such approaches, researchers can investigate how mutations or modifications to the atpB subunit affect the directionality bias of ATP synthase, providing insights into bacterial adaptation to energy stress conditions. This research has implications for understanding bacterial survival mechanisms during infection and environmental stress.

How can researchers utilize recombinant atpB in the development of attenuated Salmonella vaccines?

Recombinant atpB can be strategically employed in the development of recombinant attenuated Salmonella vaccines (RASVs), which serve as vectors for delivering protective antigens against various pathogens . The integration of modified atpB into vaccine design follows the principles of regulated delayed in vivo attenuation, where the bacteria initially maintain near wild-type properties to successfully colonize host tissues before becoming attenuated to prevent disease .

Researchers can engineer Salmonella strains with mutations in atpB or with atpB under the control of regulated promoters to achieve controlled attenuation profiles. Since ATP synthase function is critical for bacterial energy metabolism, modifications that affect atpB expression or function can significantly impact bacterial fitness and virulence while preserving immunogenicity . A promising approach involves placing atpB under the control of an arabinose-regulated promoter system (such as the araC PBAD), allowing for normal expression during in vitro growth in the presence of arabinose but shutting down expression after vaccination when arabinose is absent in host tissues .

The development process typically begins with constructing plasmids containing the modified atpB gene, followed by integration into the Salmonella genome through homologous recombination . The resulting strains are thoroughly characterized for growth profiles in both permissive (arabinose-containing) and non-permissive conditions, along with assessments of ATP synthase activity, membrane potential maintenance, and virulence attenuation in animal models . Successful vaccine candidates should demonstrate sufficient colonization of lymphoid tissues to induce robust immune responses while displaying adequate attenuation to ensure safety.

This strategy can be combined with other attenuating modifications, such as regulated expression of LPS synthesis genes (rfc or rfaH), to create highly immunogenic yet safe vaccine vectors . By manipulating energy metabolism through atpB modification, researchers can develop Salmonella vaccines with finely tuned attenuation profiles suitable for various target populations.

What are the methodological approaches for studying horizontal gene transfer of atpB in the context of antibiotic resistance?

Investigating horizontal gene transfer (HGT) of the atpB gene in Salmonella in the context of antibiotic resistance requires specialized experimental approaches that can track gene movement between bacterial populations. Solid plate mating experiments represent a fundamental methodology for studying this process in controlled laboratory conditions . These experiments involve co-culturing a donor strain carrying the atpB gene variant of interest (potentially with associated antibiotic resistance markers) with a recipient strain on solid media, allowing for direct cell-to-cell contact that facilitates genetic exchange .

A typical protocol begins with growing overnight cultures of donor and recipient strains on appropriate media (such as sheep blood agar), followed by preparation of bacterial suspensions in PBS at specific dilutions (e.g., 10,000-fold dilution for recipients and 100,000-fold dilution for donors) . The recipient bacteria are first plated on selective media (like CHROMagar) and incubated for several hours to establish a bacterial lawn before the donor suspension is overlaid . After 18-24 hours of co-incubation, samples from different regions of the plate are collected, processed through vigorous agitation to suspend cells, and then plated on selective media containing relevant antibiotics to identify recombinant populations that have acquired the gene of interest .

To specifically track atpB transfer, researchers can employ genetic approaches such as tagging the gene with selectable markers or using PCR-based detection methods to identify successful gene transfer events. Whole genome sequencing of transconjugant colonies provides comprehensive evidence of gene transfer and can reveal additional genetic elements that may have been co-transferred. The frequency of transfer can be calculated as the ratio of transconjugants to either donor or recipient cells, providing quantitative data on transfer efficiency . This methodology allows researchers to investigate whether modifications to atpB that affect ATP synthase function might influence bacterial fitness and potentially spread through horizontal transfer, particularly in environments where antibiotics exert selective pressure.

What are the common challenges in expressing and purifying membrane proteins like atpB and how can they be overcome?

Expressing and purifying membrane proteins like Salmonella paratyphi A atpB presents significant challenges due to their hydrophobic nature, complex folding requirements, and potential toxicity to expression hosts . One major challenge is the tendency of overexpressed membrane proteins to aggregate in inclusion bodies or cause growth inhibition in E. coli expression systems . To overcome this, researchers can employ specialized E. coli strains designed for membrane protein expression (such as C41(DE3), C43(DE3), or Lemo21(DE3)) that have adaptations to tolerate membrane protein overexpression.

Expression conditions require careful optimization, particularly induction parameters. Using lower temperatures (16-20°C) during induction, reduced inducer concentrations, and slower induction protocols often improves the yield of properly folded membrane proteins . The addition of specific lipids or membrane-stabilizing compounds to the growth medium can also enhance proper membrane integration. For atpB specifically, co-expression with chaperones or other ATP synthase subunits might improve folding and stability.

During purification, selecting appropriate detergents is crucial for extracting atpB from membranes while maintaining its native structure . A detergent screening approach is often necessary, testing mild detergents like n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin. The purification protocol typically includes membrane isolation, solubilization with optimized detergent, and immobilized metal affinity chromatography utilizing the N-terminal His-tag . Size exclusion chromatography as a polishing step helps remove aggregates and ensures homogeneity.

For functional studies, considering detergent exchange to more suitable options for downstream applications or reconstitution into nanodiscs or liposomes may be necessary to maintain activity. Protein stability can be enhanced by adding specific lipids that interact with atpB or by optimizing buffer conditions (pH, salt concentration, and additives like glycerol or trehalose) .

How can researchers troubleshoot activity assays for recombinant atpB in ATP synthase functional studies?

Activity assays for atpB in ATP synthase functional studies present unique challenges due to the protein's role as part of a multisubunit complex and its membrane-embedded nature. When troubleshooting these assays, researchers should first consider whether they are working with isolated atpB or the protein incorporated into the complete ATP synthase complex, as the isolated subunit alone may not display measurable activity without its partner subunits .

For studies involving the complete ATP synthase complex containing recombinant atpB, common issues include low activity levels or inconsistent results. These problems often stem from incomplete complex assembly, improper orientation in membrane mimetic systems, or loss of essential lipids during purification. Researchers can address these issues by verifying complex integrity through native gel electrophoresis or analytical ultracentrifugation, optimizing the lipid composition in reconstitution mixtures, and ensuring the correct orientation of the complex in proteoliposomes using established protocols with probes that detect orientation .

When using the Seahorse XF96 Analyzer for simultaneous measurement of synthetic and hydrolytic activities, calibration issues may arise that affect the accuracy of pH and oxygen measurements . Regular calibration with standard solutions and careful preparation of identical well volumes are essential. Background signals should be determined with appropriate controls, including samples treated with specific inhibitors of ATP synthase to distinguish ATP synthase-specific signals from other processes affecting pH or oxygen consumption .

If studying the effects of potential inhibitors or modulators on atpB function, researchers should establish dose-response relationships and verify that the compounds directly interact with atpB rather than affecting other components or creating artifacts. Direct binding assays using techniques like isothermal titration calorimetry or microscale thermophoresis can confirm specific interactions with the atpB subunit.

What approaches are recommended for generating and validating site-directed mutations in atpB for structure-function studies?

Site-directed mutagenesis of atpB enables detailed structure-function analyses of this critical ATP synthase component. The process begins with careful selection of mutation sites based on sequence conservation analysis, structural information (if available), or computational predictions of functional residues. Particularly relevant targets include charged residues in transmembrane regions that may participate in proton translocation and residues at subunit interfaces that contribute to complex assembly and stability.

For generating mutations, several molecular approaches are available. PCR-based methods, such as overlap extension PCR or the QuikChange protocol, allow precise introduction of desired mutations into the atpB coding sequence . When creating expression constructs, it's advisable to maintain the His-tag or other affinity tags used in the wild-type protein to ensure comparable purification efficiency . Following mutagenesis, thorough DNA sequencing verification is essential to confirm the presence of the intended mutation and absence of unintended changes.

Functional validation requires integrating the mutant atpB into ATP synthase complexes and conducting comparative analyses with wild-type complexes. ATP synthesis/hydrolysis assays, proton translocation measurements, and membrane potential assessments provide direct functional insights . Advanced biophysical techniques like cryo-electron microscopy or cross-linking mass spectrometry can reveal structural impacts of mutations on complex assembly and subunit interactions. The combined data from these approaches allows researchers to establish detailed structure-function relationships for specific residues within atpB, contributing to the fundamental understanding of ATP synthase mechanics.

How can recombinant atpB research contribute to understanding Salmonella pathogenicity and host interactions?

Research on recombinant Salmonella paratyphi A atpB can provide significant insights into bacterial pathogenicity and host-pathogen interactions through several interconnected pathways. As a component of ATP synthase, atpB plays a crucial role in energy metabolism, which directly influences bacterial survival and virulence expression within host environments . By studying how modifications to atpB affect ATP production capacity, researchers can understand how Salmonella adapts its energy metabolism during different phases of infection.

The ATP synthase complex represents a potential target for host defense mechanisms, and recent research has revealed intriguing connections between bacterial pathogens and host immune responses. For instance, studies have shown that the Parkinson's disease-associated leucine-rich repeat kinase 2 (LRRK2) coordinates a cell-intrinsic defense response against intracellular Salmonella through the delivery of antimicrobial itaconate . This defense pathway involves the guanosine triphosphatase RAB32, which orchestrates responses that may potentially target bacterial energy metabolism systems, including ATP synthase .

Furthermore, understanding the role of atpB in membrane organization can illuminate how Salmonella exploits host cell membrane reservoirs during invasion . The bacterial ATP synthase, including atpB, contributes to membrane potential maintenance, which influences various virulence-associated processes, including type III secretion system function and efflux pump activity. By developing recombinant atpB variants and studying their impact on membrane organization and bacterial invasion capacity, researchers can uncover novel mechanisms of host-pathogen interaction.

This research area intersects with vaccination strategies, as attenuated Salmonella strains with modified atpB can be engineered to colonize host tissues sufficiently for immune stimulation while exhibiting reduced pathogenicity . The detailed understanding of how atpB contributes to in vivo fitness and immune recognition provides a foundation for rational vaccine design approaches that balance safety and immunogenicity.

What are the comparative approaches for studying atpB across different Salmonella serovars and related bacterial species?

Comparative analysis of ATP synthase subunit a (atpB) across different Salmonella serovars and related bacterial species provides valuable insights into evolutionary conservation, functional adaptation, and potential serovar-specific properties relevant to pathogenicity and host specificity. A comprehensive comparative approach begins with sequence analysis, aligning atpB sequences from various Salmonella serovars (including S. paratyphi A, S. typhi, S. typhimurium, and others) and related Enterobacteriaceae such as Escherichia coli, Shigella species, and Yersinia .

Experimental comparative approaches involve expressing and characterizing recombinant atpB proteins from different serovars under identical conditions to directly compare their biochemical properties . Parameters such as expression efficiency, stability, ATP synthase assembly competence, and functional activity (in both synthetic and hydrolytic directions) can reveal subtle differences with potential physiological significance . Cross-complementation studies, where atpB from one serovar is expressed in an atpB deletion strain of another serovar, provide functional insights into compatibility and serovar-specific requirements.

For a more comprehensive understanding, the comparative analysis can be integrated with broader genomic and proteomic data. This includes examining the operon structure and regulation of the ATP synthase genes across species, analyzing differences in interacting partners of atpB identified through techniques like crosslinking mass spectrometry, and correlating atpB sequence variations with documented differences in virulence, host range, or antibiotic resistance profiles between serovars .

How can structural biology approaches enhance our understanding of atpB function in ATP synthase?

Structural biology approaches provide critical insights into the molecular mechanisms of atpB function within the ATP synthase complex. As a membrane protein with multiple transmembrane helices, atpB presents significant challenges for structural determination, but several complementary methods can overcome these limitations to reveal its functional architecture and dynamic behavior.

Solution-state structural approaches complement these high-resolution techniques. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions and conformational changes in atpB under different conditions, revealing dynamic aspects of function. Cross-linking mass spectrometry identifies proximity relationships between specific regions of atpB and other subunits, helping to validate structural models and identify key interaction interfaces. For studying the local environment of specific residues within atpB, site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy provides information about side-chain mobility and distances to nearby structural elements.

Computational approaches like molecular dynamics simulations utilize structural data to model the dynamic behavior of atpB during proton translocation, providing testable hypotheses about the mechanisms of proton movement and coupling to rotary motion . These simulations can incorporate information about lipid interactions, which are particularly relevant for membrane proteins like atpB whose function depends on the surrounding lipid environment.

What are the emerging technologies for studying ATP synthase function that incorporate recombinant atpB?

Emerging technologies are revolutionizing the study of ATP synthase function, offering unprecedented insights into the role of atpB within this complex molecular machine. Single-molecule techniques now allow researchers to observe the rotation of individual ATP synthase molecules in real-time, providing direct visualization of the rotary mechanism that couples proton movement through atpB to ATP synthesis. These approaches typically involve immobilizing the ATP synthase complex on a surface and attaching fluorescent probes or physical markers (such as gold nanorods) to the rotating portions, allowing for observation of rotational steps, speed, and responses to different conditions .

Nanoscale approaches for membrane protein reconstitution have significantly advanced the study of ATP synthase function. Beyond traditional proteoliposomes, technologies like nanodiscs (lipid bilayers encircled by membrane scaffold proteins) provide a more controlled and homogeneous environment for studying atpB within the ATP synthase complex . These systems allow precise control of lipid composition and orientation, facilitating investigations into how lipid-protein interactions affect atpB function. Microfluidic devices coupled with these reconstituted systems enable rapid testing of different conditions and real-time monitoring of ATP synthesis or hydrolysis activities.

Advanced bioenergetic analysis platforms, such as the Seahorse XF technology, now allow simultaneous measurement of multiple parameters related to ATP synthase function . Particularly innovative is the ability to concurrently measure both ATP synthesis (via oxygen consumption) and ATP hydrolysis (via proton production) in the same sample . This approach has revealed that ATP synthase can operate in both directions simultaneously under certain conditions, with implications for understanding bacterial energy metabolism during stress.