Recombinant Salmonella paratyphi A ATP synthase subunit b (atpF)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will ship the format currently in stock unless otherwise specified. Please indicate your format preference in your order notes.
Note: We will ship the format currently in stock unless otherwise specified. Please indicate your format preference in your order notes.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and will incur additional charges. Please contact us in advance to arrange this.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; SPA3708; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL
RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.
Target Background
Function
F1F0 ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases comprise two domains: F1, the extramembrane catalytic core, and F0, the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
KEGG: spt:SPA3708
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
