Recombinant Salmonella paratyphi A Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; SPA1138; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
clsA
Target Protein Sequence
MTTFYTVVSWLVILGYWVLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAQENSSVASSLFKLCERRQGIAGVKGNQ LQLLTDSDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRDIHCRLMLD SAGSVAFFRSPWAAMMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMVMIDNYIAYTGSM NMVDPRFFKQDAGVGQWVDLMARMEGPVATAMGIVYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTATYAAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSLLVGWASRAFFSELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLVIDDTGFGADLAAVQDDYISRSRLLDARLWVKRPLWQRITERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links

KEGG: spt:SPA1138

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

What is the functional role of Cls in Salmonella Paratyphi A metabolism?

Cls (cardiolipin synthase) catalyzes the synthesis of cardiolipin (CL), a structurally unique phospholipid critical for bacterial membrane integrity, stress adaptation, and virulence. In S. Paratyphi A, ClsB (a paralog of ClsA/C) has been shown to synthesize 6-phosphatidyltrehalose (PT) and 6,6'-diphosphatidyltrehalose (diPT)—novel trehalose-containing phospholipids that activate the human immune receptor Mincle . Methodological considerations:

  • Gene deletion studies: ΔclsB mutants exhibit loss of PT/diPT production but retain CL synthesis via ClsA/C .

  • Lipidomics: Use HPLC-MS to profile lipid extracts from wild-type vs. mutant strains .

How does ClsB differ from other cardiolipin synthases in Salmonella?

ClsB has unique substrate promiscuity compared to ClsA (primary CL synthase) and ClsC (stationary-phase CL synthase) :

EnzymeSubstratesKey ProductsGrowth Phase Activity
ClsA2x Phosphatidylglycerol (PG)CLLog phase
ClsB2x PG or PG + PECL, PT, diPTStationary phase
ClsCPG + PhosphatidylethanolamineCLStress conditions

Experimental validation:

  • In vitro assays: Purify recombinant ClsB and test activity with radiolabeled substrates .

  • TLC/MS analysis: Compare lipid profiles of ΔclsA/B/C mutants .

Advanced Research Questions

What experimental strategies resolve contradictions in ClsB functional annotation?

Early studies misannotated ClsB as a CL synthase due to sequence homology. Discrepancies arise because:

  • ClsB produces PT/diPT as primary products in S. Typhi but not in E. coli .

  • CL synthesis in S. Paratyphi A is ClsA-dependent, with ClsB contributing minimally under standard conditions .
    Resolution approaches:

  • Chemotyping: Lipid profiling (HPLC-MS) outperforms phylogenetic analysis of clsB sequences .

  • Heterologous expression: Express S. Paratyphi A clsB in E. coli Δcls strains to test product specificity .

How do PT/diPT biosynthesis pathways inform vaccine adjuvant design?

PT/diPT activate Mincle, a macrophage receptor also triggered by mycobacterial cord factor . This functional convergence suggests:

  • Adjuvant potential: DiPT could substitute trehalose dimycolate (TDM) in subunit vaccines.

  • Biosynthesis hurdles: Low diPT yields in recombinant systems require optimization:

    • Codon-optimize clsB for expression in E. coli .

    • Use T7 promoter systems with induction at OD<sub>600</sub> = 0.6–0.8 .

What genomic tools exist for studying cls in S. Paratyphi A outbreaks?

The Paratype genotyping framework identifies cls variants across 18 genotypes :

Genotypecls SNP ProfileGeographic PrevalenceAMR Correlation
2.3C→T at position 717 (AcrB)South AsiaMDR plasmids
3.1Wild-type clsBGlobalSusceptible

Application:

  • Phylogenetic mapping: Use RAxML with SNP alignments from 1,379 genomes .

  • CRISPR interference: Knock down clsB in outbreak strains to assess lipidome changes .

Methodological Challenges & Solutions

How to optimize recombinant ClsB expression for structural studies?

Challenges:

  • Membrane protein instability (50% loss in 24h at 4°C) .

  • Low solubility in E. coli (~15% in soluble fraction) .
    Solutions:

  • Expression vector: Use pET-28a with N-terminal His-tag and tobacco etch virus (TEV) site .

  • Detergent screening: Test n-dodecyl-β-D-maltopyranoside (DDM) vs. lauryl maltose neopentyl glycol (LMNG) .

Why do lipidomics studies yield conflicting ClsB activity data across Salmonella serovars?

Discrepancies arise from:

  • Serovar-specific regulation: S. Typhi produces 9x more diPT than S. Paratyphi A .

  • Growth conditions: Stationary-phase cultures upregulate ClsB 4-fold .
    Standardization protocol:

  • Culture strains to OD<sub>600</sub> = 2.0 in LB + 0.5% glucose.

  • Extract lipids using Bligh-Dyer method with 2:1:0.8 CHCl<sub>3</sub>:MeOH:H<sub>2</sub>O .

Data Interpretation Frameworks

How to validate ClsB's immune activation role in murine models?

Experimental design:

  • Wild-type vs. ΔclsB: Inject C57BL/6 mice (n=10/group) with 10<sup>6</sup> CFU; measure IFN-γ via ELISA .

  • diPT purification: Isolate from S. Typhi ΔclsA mutant .

  • Mincle<sup>-/-</sup> controls: Confirm receptor specificity .

What systems biology approaches integrate ClsB data with multi-omics datasets?

  • Metabolite correlation: Map diPT levels to transcriptomic data (e.g., phoPQ activation) .

  • Machine learning: Train random forest models on lipidomic profiles to predict strain virulence .

Ethical & Safety Considerations

What biosafety protocols apply to recombinant cls studies?

  • Containment: BSL-2 for S. Paratyphi A ΔclsB mutants .

  • Antibiotic resistance: Avoid ampicillin markers; use kanamycin (50 μg/mL) for plasmid selection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.