Recombinant Salmonella paratyphi A Cobalamin biosynthesis protein CbiB (cbiB)

Shipped with Ice Packs
In Stock

Description

Overview of CbiB in Salmonella Species

CbiB is an integral membrane protein critical for the final step of de novo adenosylcobalamin (coenzyme B12) biosynthesis. In Salmonella enterica, CbiB catalyzes the conversion of adenosylcobyric acid (AdoCby) to adenosylcobinamide-phosphate, a reaction requiring ethanolamine-phosphate (EA-P) as a substrate . This phosphorylation step classifies CbiB as a synthetase rather than a synthase . While Salmonella Paratyphi A CbiB remains uncharacterized, its homologs in related species share conserved functional domains.

Recombinant CbiB Production

Recombinant CbiB proteins from Salmonella Paratyphi B and Salmonella enterica have been produced for functional studies. Key parameters for recombinant CbiB include:

ParameterDetails
Expression HostE. coli or yeast systems
TagN-terminal His tag for purification
Protein LengthFull-length (1-93aa) or partial sequences, depending on construct
Purity>85–90% (verified by SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer
SequenceIncludes conserved motifs for membrane integration and phosphorylation

Mechanistic Role

  • Phosphorylation Activity: CbiB phosphorylates AdoCby using EA-P, generating adenosylcobinamide-phosphate, a precursor for cobalamin .

  • Membrane Topology: Hydropathy analysis and fusion protein studies (CbiB-LacZ/PhoA) confirm CbiB’s integration into the cytoplasmic membrane, with critical residues exposed to both the periplasm and cytosol .

Substrate Specificity

  • EA-P vs. L-Thr-P: CbiB exclusively utilizes EA-P, not L-Thr-P, as a substrate .

  • Norcobalamin Synthesis: When EA-P is used, Salmonella produces norcobalamin (lacking the C176 methyl group), highlighting substrate-dependent product variation .

Enzymatic Compensation

Overexpression of CbiB in cobU/ycfN mutants lacking AdoCbi kinase activity partially restores cobalamin biosynthesis, suggesting CbiB can phosphorylate AdoCbi under high-expression conditions .

Unresolved Questions for Paratyphi A

  • Structural differences between CbiB in Paratyphi A vs. Paratyphi B/enterica.

  • Pathogen-specific roles of CbiB in virulence or metabolic adaptation.

Experimental Applications of Recombinant CbiB

Recombinant CbiB is used to:

  • Study cobalamin biosynthesis mechanisms in pathogenic Salmonella.

  • Screen inhibitors targeting B12 metabolism as potential antimicrobials.

  • Investigate membrane protein engineering and phosphorylation dynamics .

Limitations of Current Data

  • Species Discrepancy: No direct data on Salmonella Paratyphi A CbiB; inferences rely on homologs.

  • Functional Assays: Most studies use Salmonella enterica; validation in Paratyphi A is needed.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development based on your request.
Synonyms
cbiB; SPA0837; Cobalamin biosynthesis protein CbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
cbiB
Target Protein Sequence
MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGVTWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEFERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSDWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRGISVDDISRTIRLMWVA STLALALFIAARCGLSGVA
Uniprot No.

Target Background

Function
CbiB catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group. However, the true cosubstrate could be (R)-1-amino-2-propanol O-2-phosphate, resulting in cobinamide phosphate.
Database Links

KEGG: spt:SPA0837

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical role of CbiB in the cobalamin biosynthetic pathway?

CbiB catalyzes the conversion of adenosylcobyric acid (AdoCby) to adenosylcobinamide-phosphate (AdoCbi-P), which represents the final step in the de novo corrin ring biosynthetic branch of the adenosylcobalamin (coenzyme B12) pathway . This critical conversion involves the addition of an aminopropanol phosphate linker to the f-side chain of adenosylcobyric acid. Research has demonstrated that CbiB likely activates AdoCby through phosphorylation, suggesting it functions as a synthetase rather than a synthase .

The reaction catalyzed by CbiB can be represented as:

Adenosylcobyric acid + Ethanolamine-phosphate → Adenosylcobinamide-phosphate

Following this reaction, AdoCbi-P is further processed by the CobU enzyme to form AdoCbi-GDP, which ultimately leads to the synthesis of adenosylcobalamin through additional enzymatic steps .

How is recombinant Salmonella paratyphi A CbiB protein properly stored and handled?

For optimal stability and functionality, recombinant Salmonella paratyphi A CbiB protein should be stored in a Tris-based buffer with 50% glycerol . The recommended storage conditions are:

Storage PurposeTemperatureDuration
Standard storage-20°CMonths
Extended storage-80°CYears
Working aliquots4°CUp to one week

It's important to note that repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and functionality . When working with the recombinant protein, researchers should maintain sterile conditions and minimize exposure to proteases.

What experimental approaches can be used to investigate CbiB topology in the cell membrane?

To investigate CbiB topology in the cell membrane, researchers can employ several complementary approaches:

  • Protein Fusion Techniques: Construct CbiB-LacZ and CbiB-PhoA protein fusions at various positions throughout the protein sequence. LacZ activity indicates cytoplasmic localization, while PhoA activity suggests periplasmic exposure . This systematic approach helped define the membrane orientation of CbiB in previous studies.

  • Cysteine Scanning Mutagenesis: Introduce cysteine residues at specific positions and test their accessibility to membrane-impermeable sulfhydryl reagents to determine exposure to different cellular compartments.

  • Epitope Insertion and Antibody Accessibility: Insert epitope tags at various positions and assess their accessibility using antibodies under permeabilized and non-permeabilized conditions.

  • Protease Protection Assays: Treat membrane preparations with proteases and identify protected fragments using Western blotting to determine membrane-embedded regions.

  • Computational Prediction Refinement: Use hydropathy analysis algorithms (TMHMM, HMMTOP) to predict transmembrane segments and refine these predictions with experimental data .

A comprehensive approach combining these methods provides the most reliable topology model. The experimental design should include appropriate controls and account for potential disruptions to protein folding caused by the fusion constructs or mutations.

How does substrate specificity of CbiB impact the synthesis of different cobamide variants?

CbiB exhibits distinct substrate preferences that directly influence the final cobamide products synthesized by Salmonella. Research has established that:

  • Substrate Selectivity: Ethanolamine-phosphate (EA-P) serves as an effective substrate for CbiB, while L-threonine phosphate (L-Thr-P) does not . This selectivity reflects the enzyme's evolved preference for specific aminopropanol donors.

  • Cobamide Variant Production: When EA-P is utilized as the substrate by CbiB, Salmonella typhimurium has been shown to synthesize norcobalamin, which lacks the methyl group at C176 of the standard cobalamin structure . This demonstrates how alternative substrates can lead to structural variations in the final cobalamin products.

  • Functional Implications: The production of different cobamide variants impacts their biological activity and potentially influences bacterial metabolism and virulence. The synthesis of norcobalamin suggests flexibility in the cobalamin biosynthetic pathway that may confer selective advantages under certain environmental conditions.

To investigate substrate specificity experimentally, researchers can:

  • Conduct in vitro enzyme assays with purified CbiB and various potential substrates

  • Analyze the reaction products using mass spectrometry to identify structural modifications

  • Perform substrate competition experiments to determine relative affinities

  • Use site-directed mutagenesis to identify residues involved in substrate recognition

What are the methodological challenges in distinguishing between synthetase and synthase activity of CbiB?

Determining whether CbiB functions as a synthetase or synthase presents several methodological challenges that researchers must address:

Current evidence favors CbiB acting as a synthetase rather than a synthase based on its likely activation of AdoCby through phosphorylation , but definitive classification requires rigorous biochemical characterization using these approaches.

What purification strategies are most effective for obtaining functional recombinant CbiB protein?

Purifying functional recombinant CbiB presents unique challenges due to its nature as an integral membrane protein. Effective purification strategies include:

  • Expression System Selection:

    • E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein expression

    • Inducible expression systems with fine-tuned induction parameters to prevent formation of inclusion bodies

    • Fusion tags that enhance solubility while maintaining protein function

  • Membrane Extraction:

    • Gentle cell lysis using French press or sonication with protease inhibitors

    • Membrane fraction isolation through differential centrifugation

    • Gradual solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that preserve protein structure and function

  • Chromatographic Techniques:

    • Initial capture using affinity chromatography (His-tag or FLAG-tag)

    • Intermediate purification with ion exchange chromatography

    • Size exclusion chromatography for final polishing and detergent exchange

  • Activity Preservation:

    • Addition of stabilizing agents like glycerol (typically 10-20%)

    • Inclusion of relevant cofactors or substrate analogs

    • Maintaining physiological pH and ionic strength

  • Quality Assessment:

    • SDS-PAGE and Western blot analysis to verify purity

    • Circular dichroism to confirm secondary structure

    • Activity assays to ensure functional integrity

A typical purification protocol would begin with expression in an appropriate bacterial system, followed by membrane isolation, detergent solubilization, and sequential chromatography steps while maintaining conditions that preserve protein stability and function throughout the process.

How can researchers accurately assess CbiB enzymatic activity in vitro?

Assessing CbiB enzymatic activity presents several technical challenges due to its membrane localization and the complexity of the reaction it catalyzes. Recommended methodologies include:

  • Substrate Preparation:

    • Chemical or enzymatic synthesis of adenosylcobyric acid (AdoCby)

    • Radiolabeling strategies using 32P-labeled ethanolamine-phosphate

    • Preparation of substrate analogs with fluorescent or affinity tags

  • Reaction Conditions Optimization:

    • Buffer composition (pH 7.2-7.8, physiological salt concentration)

    • Divalent metal ion requirements (Mg2+, Mn2+)

    • Detergent selection to maintain enzyme in native-like membrane environment

    • Temperature and time course optimization

  • Activity Measurement Techniques:

    • HPLC separation of substrates and products

    • Mass spectrometry to identify reaction intermediates and products

    • Radiochemical assays tracking incorporation of labeled substrates

    • Coupled enzyme assays monitoring nucleotide consumption

  • Data Analysis:

    • Determination of kinetic parameters (Km, Vmax, kcat)

    • Substrate specificity profiles comparing different aminopropanol donors

    • Inhibition studies to elucidate catalytic mechanism

  • Validation Approaches:

    • Correlation with in vivo activity using genetic complementation

    • Comparison with CbiB variants containing known functional mutations

    • Controls excluding essential components to verify reaction requirements

A comprehensive approach might involve reconstituting purified CbiB into liposomes or nanodiscs to maintain a membrane-like environment, followed by incubation with substrates under optimized conditions and analysis of products using LC-MS/MS for definitive characterization.

What experimental systems are available for studying the in vivo function of CbiB in Salmonella paratyphi A?

Several experimental systems can be employed to study CbiB function in vivo:

  • Genetic Manipulation Approaches:

    • Targeted gene knockout using λ-Red recombination system

    • Complementation with wild-type and mutant alleles

    • Conditional expression systems (arabinose-inducible or tetracycline-regulated)

    • Site-directed mutagenesis to create specific amino acid substitutions

    • Epitope tagging for localization and interaction studies

  • Growth-Based Functional Assays:

    • Minimal media lacking cobalamin to assess de novo biosynthesis

    • Growth curves under various conditions to quantify phenotypic effects

    • Competition assays between wild-type and cbiB mutant strains

    • Bioassays using cobalamin-dependent indicator strains

  • Metabolite Analysis:

    • Extraction and quantification of cobalamin intermediates

    • Metabolic labeling with isotope tracers

    • Two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) to detect metabolite profiles

    • Targeted and untargeted metabolomics approaches

  • Host-Pathogen Interaction Models:

    • Tissue culture infection models

    • Animal infection models where appropriate (with proper ethical considerations)

    • Ex vivo studies using human samples from enteric fever patients

  • Advanced Microscopy Techniques:

    • Fluorescent protein fusions to visualize CbiB localization

    • Super-resolution microscopy to determine membrane distribution

    • FRET-based approaches to study protein-protein interactions

When establishing these systems, researchers should consider the specialized growth requirements of Salmonella paratyphi A and ensure that genetic manipulations maintain the integrity of operons and avoid polar effects on downstream genes.

How might CbiB function contribute to Salmonella paratyphi A pathogenesis and host-pathogen interactions?

The role of CbiB in cobalamin biosynthesis has significant implications for Salmonella paratyphi A pathogenesis:

  • Metabolic Adaptation: Cobalamin is an essential cofactor for several metabolic enzymes. CbiB's function in cobalamin biosynthesis enables S. paratyphi A to:

    • Utilize alternative carbon and energy sources in nutrient-limited environments

    • Maintain metabolic flexibility during infection

    • Compete effectively with host microbiota during colonization

  • Survival in Host Environments:

    • Cobalamin-dependent metabolic pathways may be crucial for survival within macrophages

    • De novo synthesis capability provides independence from host-derived cobalamin

    • Growth advantages in the cobalamin-limited intracellular environment

  • Virulence Regulation:

    • Metabolic shifts enabled by cobalamin may regulate virulence factor expression

    • Cobalamin-dependent gene regulation could coordinate adaptation to host niches

    • Specialized cobamide variants may serve as signaling molecules

  • Host Response Modulation:

    • Distinct metabolite profiles associated with S. paratyphi A infection, potentially influenced by cobalamin metabolism, can be detected in patient plasma

    • Six specific metabolites have been identified that can differentiate between S. Typhi and S. Paratyphi A infections

    • These metabolic signatures may reflect pathogen-specific host responses

  • Biomarker Potential:

    • Metabolites associated with cobalamin biosynthesis could serve as diagnostic biomarkers

    • GCxGC/TOFMS has identified reproducible and serovar-specific metabolite profiles that can distinguish S. paratyphi A infections from other enteric fevers

Future research should investigate the specific contribution of CbiB function to these aspects of pathogenesis through selective mutation and complementation studies, host-pathogen interaction models, and metabolomic profiling.

What approaches can be used to identify inhibitors of CbiB function as potential antimicrobial agents?

Targeting CbiB function represents a promising avenue for antimicrobial development, with several complementary approaches available:

  • High-Throughput Screening (HTS) Strategies:

    • Biochemical assays measuring CbiB enzymatic activity in microplate format

    • Whole-cell screens using reporter systems linked to cobalamin biosynthesis

    • Phenotypic screens in cobalamin-dependent growth conditions

    • Fragment-based screening to identify chemical starting points

  • Structure-Based Drug Design:

    • Homology modeling based on related proteins with known structures

    • Molecular docking to identify potential binding sites and ligands

    • Virtual screening of compound libraries against predicted binding pockets

    • Structure-activity relationship studies to optimize lead compounds

  • Rational Design Approaches:

    • Development of substrate analogs that competitively inhibit CbiB

    • Transition state mimics that exploit the catalytic mechanism

    • Allosteric inhibitors targeting regulatory sites

    • Membrane-disrupting agents that affect CbiB topology and function

  • Validation Methodologies:

    • Target engagement assays to confirm direct binding to CbiB

    • Metabolomic profiling to verify pathway inhibition

    • Genetic approaches (overexpression, resistant mutants) to confirm specificity

    • Combination studies with existing antibiotics to assess synergistic potential

  • Translational Considerations:

    • Selectivity profiling against human enzymes to minimize toxicity

    • Assessment of resistance development potential

    • Pharmacokinetic and pharmacodynamic evaluation

    • Formulation strategies for membrane-targeted compounds

The integral membrane nature of CbiB presents both challenges and opportunities for inhibitor development. Successful approaches will likely require specialized screening systems that maintain the protein in a membrane-like environment while allowing for efficient compound testing and analysis.

How can comparisons between CbiB proteins from different Salmonella serovars provide insights into functional evolution?

Comparative analysis of CbiB proteins across Salmonella serovars offers valuable insights into evolutionary adaptation:

  • Sequence Conservation Analysis:

    • Multiple sequence alignment of CbiB proteins from diverse Salmonella serovars

    • Identification of conserved motifs associated with core functions

    • Mapping of variable regions that might relate to serovar-specific adaptations

    • Calculation of selection pressures (dN/dS ratios) to identify regions under positive selection

  • Structure-Function Correlations:

    • Homology modeling of different CbiB variants

    • Mapping of sequence variations onto structural models

    • Prediction of functional consequences of amino acid substitutions

    • Identification of serovar-specific structural features

  • Experimental Validation Approaches:

    • Cross-complementation studies using CbiB from different serovars

    • Generation of chimeric proteins to map functional domains

    • Site-directed mutagenesis to convert one serovar's specificity to another

    • Biochemical characterization of substrate preferences across variants

  • Evolutionary Context Analysis:

    • Phylogenetic reconstruction of CbiB evolution within Enterobacteriaceae

    • Correlation with host range and pathogenicity patterns

    • Analysis of horizontal gene transfer events

    • Investigation of co-evolution with other cobalamin biosynthesis genes

  • Clinical and Epidemiological Relevance:

    • Correlation of CbiB variants with disease presentation

    • Analysis of CbiB polymorphisms in clinical isolates

    • Potential impact on diagnostic approaches based on metabolite profiles

    • Evaluation of CbiB as a target for serovar-specific interventions

For example, comparing CbiB between S. enterica serovar Typhimurium and S. paratyphi A reveals subtle differences that may contribute to their distinct metabolic profiles . These differences could be exploited for developing more precise diagnostic approaches and targeted therapeutics.

What quality control measures are essential when working with recombinant Salmonella paratyphi A CbiB protein?

Ensuring the quality and functionality of recombinant CbiB protein requires comprehensive quality control measures:

  • Purity Assessment:

    • SDS-PAGE with Coomassie or silver staining (target >95% purity)

    • Western blotting with specific antibodies or tag detection

    • Mass spectrometry for identity confirmation and detection of modifications

    • Size exclusion chromatography to assess aggregation state

  • Structural Integrity Verification:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to determine stability

    • Limited proteolysis to verify proper folding

    • Native PAGE to assess oligomeric state

  • Functional Validation:

    • Enzymatic activity assays comparing to established benchmarks

    • Substrate binding studies using isothermal titration calorimetry

    • Complementation of cbiB-deficient bacterial strains

    • Detergent compatibility and membrane incorporation assessment

  • Storage Stability Monitoring:

    • Activity retention after storage under recommended conditions

    • Freeze-thaw stability testing

    • Accelerated stability studies at elevated temperatures

    • Long-term activity monitoring with periodic testing

  • Batch Consistency Verification:

    • Lot-to-lot comparison of key parameters

    • Reference standard establishment

    • Certificate of analysis documentation including:

      • Protein concentration (typically provided as 50 μg per vial)

      • Buffer composition (Tris-based buffer with 50% glycerol)

      • Endotoxin levels

      • Date of production and expiration

Researchers should establish acceptance criteria for each quality parameter based on their specific experimental requirements and maintain detailed records of quality control results to ensure reproducibility across studies.

How can researchers address challenges in expressing and purifying membrane proteins like CbiB?

Expressing and purifying membrane proteins such as CbiB presents unique challenges that can be addressed through specialized approaches:

  • Expression System Optimization:

    • Host Selection: Use specialized strains like C41(DE3), C43(DE3), or Lemo21(DE3) engineered for membrane protein expression

    • Induction Conditions: Employ lower temperatures (16-20°C), reduced inducer concentrations, and extended expression times

    • Fusion Partners: Incorporate solubility-enhancing tags (MBP, SUMO) or reporter fusions (GFP) to monitor folding

    • Codon Optimization: Adjust coding sequence to match host preferences without altering critical functional elements

  • Membrane Extraction Strategies:

    • Detergent Screening: Systematically test multiple detergents including:

      • Mild detergents (DDM, LMNG)

      • Zwitterionic detergents (CHAPS, Fos-Choline)

      • Nonionic detergents (Triton X-100, digitonin)

    • Alternative Solubilization: Explore styrene-maleic acid copolymer (SMA) for native nanodiscs

    • Selective Extraction: Use differential solubilization to enhance purity

  • Stability Enhancement:

    • Lipid Supplementation: Add specific phospholipids that maintain native environment

    • Stabilizing Additives: Include glycerol, cholesterol hemisuccinate, or specific ions

    • Ligand Addition: Incorporate substrates or substrate analogs during purification

    • Engineering Approaches: Introduce disulfide bonds or remove flexible regions

  • Alternative Reconstitution Methods:

    • Proteoliposomes: Reconstitute into artificial liposomes for functional studies

    • Nanodiscs: Incorporate into defined lipid bilayers with membrane scaffold proteins

    • Amphipols: Transfer from detergent to amphipathic polymers for increased stability

    • Bicelles: Use lipid-detergent mixtures that mimic native membrane environment

  • Specialized Characterization:

    • Detergent Quantification: Ensure appropriate detergent:protein ratios

    • Lipid Analysis: Identify co-purifying lipids that may be functionally important

    • Dynamic Light Scattering: Assess homogeneity of protein-detergent complexes

    • Native Mass Spectrometry: Determine oligomeric state in detergent micelles

These approaches should be systematically evaluated and optimized for CbiB, with careful documentation of successful conditions to ensure reproducibility.

What advanced analytical techniques are most suitable for characterizing CbiB structure-function relationships?

Advanced analytical techniques can provide crucial insights into CbiB structure-function relationships:

  • Structural Characterization Methods:

    • Cryo-Electron Microscopy: Ideal for membrane proteins, enabling visualization of CbiB in detergent micelles or nanodiscs without crystallization

    • X-ray Crystallography: Challenging but potentially high-resolution approach requiring specialized crystallization techniques for membrane proteins

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Maps solvent-accessible regions and conformational changes upon substrate binding

    • Solid-State NMR: Characterizes structure and dynamics in membrane-like environments

  • Functional Mapping Techniques:

    • Site-Directed Spin Labeling with EPR: Measures distances between specific residues in different conformational states

    • Single-Molecule FRET: Monitors conformational changes during catalytic cycle

    • Cross-linking Mass Spectrometry: Identifies residue proximity and interaction interfaces

    • Chemical Modification Coupled with Mass Spectrometry: Maps accessible residues and catalytic sites

  • Interaction Characterization:

    • Surface Plasmon Resonance: Measures binding kinetics with substrates and potential inhibitors

    • Microscale Thermophoresis: Determines binding affinities in detergent solutions

    • Isothermal Titration Calorimetry: Provides thermodynamic parameters of binding events

    • Native Mass Spectrometry: Identifies stable protein complexes and bound cofactors

  • Dynamic Assessment:

    • Molecular Dynamics Simulations: Models protein behavior in membrane environments

    • Hydrogen-Exchange Mass Spectrometry: Reveals regions with different conformational flexibility

    • Time-Resolved Spectroscopy: Captures transient intermediates during catalysis

    • Temperature-Dependent Activity Profiling: Identifies thermodynamic parameters of the catalytic process

  • In-Membrane Analysis:

    • Atomic Force Microscopy: Images protein organization in reconstituted membranes

    • Lipid Nanodiscs Coupled with Various Spectroscopies: Enables study in defined lipid environments

    • Proteoliposome Flux Assays: Measures transport or leakage of substrates/products

    • Electrophysiology: Detects potential channel-like properties or membrane integrity effects

Integration of multiple complementary techniques provides the most comprehensive understanding of CbiB structure-function relationships, overcoming the limitations of individual methods when applied to complex membrane proteins.

How might systems biology approaches enhance our understanding of CbiB in the context of cobalamin biosynthesis?

Systems biology approaches offer powerful frameworks for understanding CbiB function within the broader context of cobalamin biosynthesis:

These systems approaches can reveal how CbiB function is coordinated with other cellular processes and how it contributes to bacterial adaptation and pathogenesis in different environments.

What are the most significant unresolved questions regarding CbiB function and mechanism?

Despite considerable progress in understanding CbiB, several significant questions remain unresolved:

  • Mechanistic Uncertainties:

    • Catalytic Mechanism: While evidence suggests CbiB functions as a synthetase , the precise chemical steps and intermediates remain incompletely characterized.

    • ATP Utilization: If CbiB acts as a synthetase, how is ATP bound and hydrolyzed during the reaction?

    • Substrate Recognition: The molecular basis for discrimination between ethanolamine-phosphate and L-threonine-phosphate remains unclear .

    • Proton Transfer: How are protons managed during the condensation reaction, particularly given CbiB's membrane localization?

  • Structural Questions:

    • High-resolution Structure: No atomic-resolution structure of CbiB has been reported, limiting understanding of its functional domains.

    • Conformational Changes: How does CbiB structure change during the catalytic cycle?

    • Membrane Integration: The specific lipid requirements for optimal CbiB function remain undefined.

    • Oligomeric State: Whether CbiB functions as a monomer or forms higher-order complexes is still uncertain.

  • Regulatory Aspects:

    • Transcriptional Regulation: How is cbiB expression coordinated with other cobalamin biosynthesis genes?

    • Post-translational Regulation: Are there modifications that regulate CbiB activity in response to cellular conditions?

    • Metabolic Integration: How is CbiB activity coordinated with the availability of substrates and other metabolic pathways?

    • Feedback Inhibition: Does CbiB respond to end-product accumulation or depletion?

  • Evolutionary Considerations:

    • Functional Divergence: How has CbiB function evolved across different bacterial lineages?

    • Host Adaptation: Do CbiB variants in different Salmonella serovars reflect adaptation to different host environments?

    • Alternative Functions: Does CbiB have secondary roles beyond cobalamin biosynthesis?

    • Horizontal Transfer: Has the cbiB gene undergone horizontal transfer contributing to pathogen evolution?

  • Therapeutic Potential:

    • Druggability: Can the membrane-embedded nature of CbiB be exploited for selective inhibition?

    • Resistance Development: What is the potential for resistance to CbiB inhibitors?

    • In vivo Essentiality: Is CbiB function truly essential during infection, or can alternate pathways compensate?

    • Structure-Based Design: Without high-resolution structures, can effective inhibitors be developed?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational modeling.

How does research on CbiB contribute to our broader understanding of bacterial metabolic adaptations during infection?

Research on CbiB provides valuable insights into bacterial metabolic adaptations during infection:

  • Metabolic Self-Sufficiency:

    • The ability to synthesize cobalamin de novo represents a significant metabolic advantage for pathogens in nutrient-limited host environments .

    • CbiB's role in this pathway illustrates how bacteria maintain metabolic independence from host-derived factors.

    • This self-sufficiency may be particularly important in intracellular compartments where cobalamin is limited.

  • Niche-Specific Adaptations:

    • Different Salmonella serovars show distinct metabolite profiles during infection, suggesting specialized metabolic adaptations .

    • The ability to produce different cobamide variants (like norcobalamin) through CbiB may reflect adaptation to specific host niches .

    • These metabolic signatures can serve as biomarkers for infection and potentially indicate virulence potential.

  • Host-Pathogen Metabolic Interactions:

    • Metabolomic studies have identified reproducible and serovar-specific biomarkers during enteric fever, demonstrating how pathogen metabolism influences host responses .

    • Six specific metabolites can accurately distinguish between S. Typhi and S. Paratyphi A infections, highlighting the specificity of host-pathogen metabolic interactions .

    • These interactions may reveal new diagnostic approaches and therapeutic targets.

  • Evolutionary Trade-offs:

    • Maintaining the cobalamin biosynthetic pathway represents a significant genetic and energetic investment.

    • CbiB research helps illuminate why this investment is maintained despite the availability of exogenous cobalamin in some environments.

    • Understanding these trade-offs provides insights into bacterial genome evolution and specialization.

  • Metabolic Network Resilience:

    • CbiB's role in a complex biosynthetic pathway illustrates how bacteria maintain robust metabolic networks.

    • The integration of membrane-bound enzymes like CbiB with cytosolic pathways demonstrates sophisticated cellular organization.

    • This organization may contribute to metabolic resilience during stress conditions encountered during infection.

By studying CbiB and similar metabolic enzymes, researchers gain a more comprehensive understanding of how pathogens adapt their metabolism to survive and thrive in changing host environments, potentially revealing new approaches for antimicrobial development and diagnostic techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.