Recombinant Salmonella paratyphi A Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant CobS is produced via heterologous expression in E. coli, leveraging the host’s machinery for high-yield protein synthesis. The purification process typically employs immobilized metal affinity chromatography (IMAC) targeting the N-terminal His tag .

Key steps:

  • Cloning: The cobS gene is inserted into a plasmid under a strong promoter (e.g., T7 or lac).

  • Induction: Expression is induced using IPTG or autoinduction media.

  • Purification: IMAC followed by size-exclusion chromatography for monomeric isolation .

Functional Role in Cobalamin Biosynthesis

CobS is part of the cob operon, which is tightly regulated by oxygen and cobalamin levels . Its enzymatic activity includes:

  • Adenosylation: Transfer of an adenosyl group from ATP to the cobalt center of cobalamin precursors .

  • Substrate Specificity: Preferentially binds cob(II)inamide, a cobalamin precursor lacking the nucleotide loop .

Regulatory Insights:

  • Expression of cobS is repressed under aerobic conditions but induced during anaerobic respiration .

  • Mutants lacking cobS in Salmonella serovars (e.g., Enteritidis, Pullorum) show no virulence impairment in avian models, suggesting redundant pathways or non-essential roles in acute infections .

4.1. Diagnostic Tools

Recombinant CobS is utilized in ELISA kits to detect S. Paratyphi A-specific antibodies, aiding in serological studies of enteric fever .

4.2. Antimicrobial Target Exploration

Although cobS deletion does not attenuate virulence in chickens , its role in cobalamin-dependent metabolism makes it a potential target for disrupting bacterial survival under nutrient-limited conditions.

Challenges and Future Directions

  • Vaccine Development: While CobS itself is not a vaccine candidate, its regulatory pathways (e.g., oxygen-sensitive expression) inform the design of live-attenuated vaccines .

  • Metabolic Engineering: Optimizing CobS activity could enhance microbial cobalamin production for industrial applications.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; SSPA0799; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGISGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAVACAAGHGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLATMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL
Uniprot No.

Target Background

Function
Catalyzes the conversion of adenosylcobinamide-GDP and alpha-ribazole to adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: sek:SSPA0799

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and its role in Salmonella paratyphi A?

Cobalamin synthase (cobS) is a crucial enzyme in the vitamin B12 (cobalamin) biosynthetic pathway in Salmonella species. This enzyme, also known as adenosylcobinamide-GDP ribazoletransferase or cobalamin-5'-phosphate synthase, catalyzes one of the final steps in cobalamin synthesis. In Salmonella paratyphi A, cobS contributes to bacterial metabolism and potentially to pathogenicity through the production of vitamin B12, an essential cofactor for several metabolic processes. The protein typically consists of 247 amino acids and functions within the complex cobalamin biosynthetic pathway that involves approximately 20 genes in the cob operon . The cobS enzyme specifically catalyzes the attachment of the lower axial ligand to the corrin ring structure, a critical step in generating the functional cobalamin molecule.

How does cobS expression differ between S. paratyphi strains and under various growth conditions?

Cobalamin synthase expression in Salmonella species is highly regulated and shows significant variation between growth conditions. A critical observation is that cobalamin synthesis in Salmonella is predominantly observed under anaerobic conditions . Studies with S. typhimurium have demonstrated that when recombinant strains containing the cob operon were constructed, cobalamin production was only detected during anaerobic growth . This oxygen-dependent regulation likely applies to S. paratyphi A as well, with implications for experimental design when studying cobS.

Between different S. paratyphi strains, expression levels may vary based on genetic differences and environmental adaptations. The complete regulation mechanisms remain an active area of research, particularly regarding how pathogenic strains might have evolved different regulatory networks for cobS expression compared to non-pathogenic strains.

What is the relationship between cobS function and S. paratyphi A pathogenicity?

While not directly addressed in the provided research, the relationship between cobS and S. paratyphi A pathogenicity likely involves several mechanisms. S. paratyphi A is responsible for an increasing portion of enteric fever cases globally, a concerning trend as current vaccines lack adequate cross-protection against paratyphoid fever A . Cobalamin synthesis may contribute to pathogenicity by:

  • Enhancing bacterial survival in the host environment through metabolic advantages

  • Potentially interacting with host vitamin B12 metabolism

  • Supporting bacterial growth under the anaerobic or microaerobic conditions found in intestinal environments

The pathogenicity mechanisms of S. paratyphi A involve multiple factors beyond cobS, including Type III secretion system components like SptP, which regulates intracellular replicative niches through protein dephosphorylation . Understanding cobS in this broader context of virulence factors provides important insights into its potential contribution to bacterial pathogenesis.

What are the optimal expression and purification conditions for recombinant S. paratyphi A cobS protein?

Based on established protocols for similar proteins, the optimal expression and purification conditions for recombinant S. paratyphi A cobS would involve:

Expression System and Conditions:

  • Host: E. coli expression systems (BL21 or similar strains)

  • Vector: pET series with N-terminal His-tag

  • Induction: IPTG at 0.5-1.0 mM when OD600 reaches 0.6-0.8

  • Temperature: 18-25°C for 16-18 hours (to maximize soluble protein)

  • Growth conditions: Anaerobic or microaerobic environment to mimic native expression conditions

Purification Protocol:

  • Initial capture: Ni-NTA affinity chromatography

  • Buffer composition: Tris/PBS-based buffer, pH 8.0 with 6% Trehalose

  • Secondary purification: Size exclusion chromatography

  • Storage: Lyophilized powder or aliquoted in storage buffer with 50% glycerol

The recombinant protocol should aim for purity greater than 90% as determined by SDS-PAGE . Specific considerations include avoiding repeated freeze-thaw cycles and storing working aliquots at 4°C for no more than one week . For long-term storage, -20°C/-80°C is recommended with proper aliquoting to avoid degradation .

How can structural analysis of cobS inform vaccine development efforts against S. paratyphi A?

Structural analysis of cobS can significantly inform vaccine development through multiple mechanisms:

  • Epitope Identification: Detailed structural characterization can reveal surface-exposed regions of cobS that might serve as potential B-cell epitopes.

  • Conserved Regions: Structural comparison of cobS across Salmonella serovars can identify conserved domains that might elicit cross-protective immunity.

  • Structure-Function Relationship: Understanding how cobS structure relates to its function can identify critical regions that, when targeted by antibodies, may neutralize enzyme activity.

  • Rational Antigen Design: The structural data can guide the design of recombinant antigens that present key immunogenic regions while excluding potentially problematic domains.

This approach aligns with current vaccine development strategies for S. paratyphi A, which focus on various cellular components as potential vaccine candidates. Research has already shown that outer membrane proteins of S. paratyphi A, including LamB, PagC, TolC, NmpC, and FadL, demonstrated significant immunoprotection in mouse models, with protection rates ranging from 70% to 95% . Similar structural approaches could determine if cobS might serve as an additional vaccine target, particularly if it shares structural features with these successful immunogens.

What methodological approaches can resolve contradictions between computational models and experimental data for cobS activity?

Resolving contradictions between computational predictions and experimental observations for cobS requires a multi-faceted approach:

  • Advanced Computational Methods: Standard DFT-based methods have shown limitations in predicting cofactor behavior in cobalamin-dependent enzymes . Implementing higher-level computational approaches such as CASSCF (Complete Active Space Self-Consistent Field) can better account for electron correlation effects that influence cobalt-nitrogen bond dynamics in the cobalamin cofactor .

  • Integrated Experimental Validation: Combining spectroscopic methods (EPR, UV-Vis, Raman) with kinetic assays to validate computational predictions about electron transfer and bond formation/cleavage events.

  • Model Refinement: Systematically refining computational models by:

    • Including explicit solvent molecules

    • Accounting for protein environment effects

    • Considering quantum effects in metal-ligand interactions

    • Incorporating flexibility in the binding pocket

  • Benchmark Studies: Conducting parallel studies on well-characterized cobalamin-dependent enzymes to establish reliable computational protocols.

Research has shown that the Co-N axial bond in cobalamin cofactors is particularly challenging to model accurately, as its length typically ranges between 2.30 Å and 2.50 Å in biological materials . CASSCF calculations have revealed that HOMO-LUMO mixing processes can create repulsive forces affecting the dimethylbenzimidazole ligand interaction with the cobalt center, potentially explaining discrepancies between computational predictions and experimental observations .

How does the cobalamin biosynthetic pathway differ between S. typhimurium and S. paratyphi A, particularly regarding cobS function?

The cobalamin biosynthetic pathways in S. typhimurium and S. paratyphi A share fundamental similarities but may differ in key regulatory aspects and enzymatic efficiencies. Based on the available research:

FeatureS. typhimuriumS. paratyphi AImplications
Gene organizationWell-characterized cob operon with 20 identified genes Less extensively characterizedMay have divergent regulatory elements
Anaerobic regulationStrict requirement for anaerobic conditions Likely similar requirementExperimental design must account for oxygen sensitivity
Cobalt incorporationEarly stage requirement in biosynthesis Presumably similarCritical for functional enzyme production
Enzymatic efficiencyRecombinant systems show up to 100× higher corrin production than wild-type UnknownPotential for engineered overproduction
Substrate specificityAccumulates precorrin-2 and precorrin-3 without cobalt UnknownMay affect pathway bottlenecks

The S. typhimurium pathway has been more extensively characterized, with studies showing that transferring the 20 genes of the cob operon into E. coli enabled the recipient to produce cobalamins de novo, a capability the organism had likely lost evolutionarily . The resulting recombinant strains produced up to 100 times more corrin than the parent S. typhimurium strain, indicating significant potential for metabolic engineering of this pathway .

One particularly interesting finding is that cobalt is required at an early stage in the biosynthesis of cobalamins in S. typhimurium, as evidenced by the accumulation of oxidized forms of precorrin-2 and precorrin-3 (factors II and III) when grown without endogenous cobalt . This requirement may represent a key regulatory point in the pathway that could differ between Salmonella species.

What experimental setup is required for analyzing anaerobic cobS expression and activity?

Analyzing anaerobic cobS expression and activity requires specialized equipment and techniques:

Required Equipment:

  • Anaerobic chamber or glove box with controlled atmosphere (<0.1 ppm O₂)

  • Gas-tight culture vessels with appropriate sampling ports

  • Oxygen sensors to monitor anaerobic conditions

  • Redox indicators (resazurin) in media to verify anaerobic status

Media Preparation:

  • Pre-reduce media by boiling and cooling under nitrogen gas

  • Include reducing agents (cysteine-HCl, thioglycolate, or dithiothreitol)

  • Supplement with appropriate electron acceptors for anaerobic respiration (nitrate, fumarate)

Experimental Protocol:

  • Prepare cultures in an anaerobic chamber

  • Use oxygen-scavenging enzyme systems (Oxyrase) for added protection

  • Seal vessels before removing from chamber

  • Process samples within chamber or use gas-tight syringes for transfers

Analytical Considerations:

  • Enzyme assays must be performed anaerobically to preserve activity

  • Rapid processing of samples to prevent oxygen exposure

  • Consider using sealed cuvettes for spectrophotometric measurements

  • Include appropriate controls for oxygen exposure

This setup is critical as research has demonstrated that cobalamin synthesis in Salmonella species is only observed under anaerobic conditions . The anaerobic requirement appears to be a fundamental feature of the pathway regulation, making strict oxygen exclusion essential for meaningful results.

How can researchers quantify cobalamin production in recombinant systems expressing S. paratyphi A cobS?

Quantifying cobalamin production in recombinant systems requires specialized analytical techniques:

Microbiological Assay:

  • Using indicator strains (such as Salmonella enterica or Escherichia coli mutants) that require exogenous cobalamin for growth

  • Growth response is compared to standard curves from known cobalamin concentrations

  • This approach has been successfully used to show that recombinant E. coli strains with the S. typhimurium cob operon produce up to 100 times more corrin than the parent strain

Chromatographic Methods:

  • HPLC analysis with UV detection (350-367 nm)

  • LC-MS/MS for more specific identification and quantification of different cobalamin forms

  • Sample preparation by extraction with cyanide to convert various cobalamin forms to cyanocobalamin

Radioactive Assays:

  • Incorporation of ⁵⁷Co or ⁶⁰Co into the cobalamin molecule

  • Allows highly sensitive detection even at low production levels

  • Particularly useful when studying biosynthetic pathways

Fluorescence-Based Detection:

  • Direct fluorescence of cobalamins (weak intrinsic fluorescence)

  • Derivatization to enhance fluorescence properties

  • Development of fluorescent reporter systems linked to cobalamin production

When implementing these methods, researchers should consider the potential for anaerobic sampling requirements and the need for appropriate controls to account for matrix effects from bacterial cultures.

What genetic approaches are most effective for studying cobS function in S. paratyphi A?

Several genetic approaches have proven effective for studying cobalamin biosynthetic genes in Salmonella species and can be applied to investigating cobS function in S. paratyphi A:

Gene Deletion/Knockout Strategies:

  • Lambda Red recombination system for precise gene deletions

  • CRISPR-Cas9 gene editing for targeted modifications

  • Transposon mutagenesis for random insertional inactivation and screening

This approach was successfully used to construct derivatives of cobalamin-producing E. coli strains in which genes of the cob operon were inactivated, allowing determination of genes necessary for cobalamin production .

Complementation Studies:

  • Trans-complementation with wild-type or mutated cobS

  • Heterologous complementation with cobS from other species

  • Domain-swapping experiments to identify functional regions

Previous work has shown that S. typhimurium cbiL mutants are not complemented with the homologous Pseudomonas denitrificans gene, highlighting the specificity of pathway components .

Reporter Fusions:

  • Transcriptional fusions (cobS promoter-reporter gene)

  • Translational fusions (CobS-reporter protein)

  • Two-hybrid systems to identify protein-protein interactions

Inducible Expression Systems:

  • Arabinose-inducible (pBAD) or IPTG-inducible (pET) systems

  • Tetracycline-responsive elements for tight regulation

  • Temperature-sensitive promoters for conditional expression

These approaches can be integrated with phenotypic assays, including growth under different conditions, virulence in infection models, and biochemical assays for cobalamin production to provide a comprehensive understanding of cobS function.

What are the critical considerations for maintaining recombinant CobS enzyme activity during purification?

Maintaining enzymatic activity during purification of recombinant CobS requires attention to several critical factors:

Buffer Composition:

  • pH stability range: Maintain pH 7.5-8.0 (Tris/PBS-based buffers)

  • Ionic strength: 150-300 mM NaCl to maintain protein solubility

  • Stabilizing agents: Include 6% Trehalose as used for similar proteins

  • Reducing agents: Add DTT or β-mercaptoethanol to prevent oxidation of sulfhydryl groups

Temperature Control:

  • Perform all purification steps at 4°C

  • Avoid repeated freeze-thaw cycles which can significantly reduce activity

  • Store working aliquots at 4°C for no more than one week

  • For long-term storage, use -20°C/-80°C with proper cryoprotectants

Cofactor Requirements:

  • Consider adding cobalt salts to buffers to maintain cofactor integrity

  • Protect from light to prevent photodegradation of cobalamin cofactors

  • Maintain anaerobic conditions when possible to protect oxygen-sensitive cofactors

Concentration and Storage:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 50% final concentration for storage

  • Aliquot to minimize freeze-thaw cycles

  • Consider lyophilization as a preservation method for longer-term storage

Following these guidelines will help ensure that purified recombinant CobS maintains its structural integrity and enzymatic activity for downstream applications in biochemical and structural studies.

How can recombinant CobS be utilized in vaccine development against S. paratyphi A infections?

Recombinant CobS offers several promising approaches for vaccine development against S. paratyphi A infections:

As a Direct Antigen:
Recombinant CobS can be evaluated as a protein subunit vaccine, potentially following the success seen with other S. paratyphi A outer membrane proteins. Previous research demonstrated that outer membrane proteins including LamB, PagC, TolC, NmpC, and FadL showed significant immunoprotection when intraperitoneally immunized at a dose of 100 μg, with protection rates reaching 95% for the most effective candidates . CobS could be similarly evaluated for its immunogenicity and protective efficacy.

As a Carrier Protein for Conjugate Vaccines:
CobS could serve as a carrier protein for O-specific polysaccharide (OSP) conjugate vaccines. Current approaches using diphtheria toxoid (DT) and CRM₁₉₇ have shown variable success, with one study showing that OSP-AH-DT conjugate elicited a strikingly higher anti-OSP response compared to LPS alone, while OSP-DT conjugate produced a poor response . CobS might provide advantages as an alternative carrier.

As Part of Live Attenuated Vaccine Strains:
The cobS gene could be manipulated in live attenuated vaccine candidates to:

  • Enhance immunogenicity through increased expression

  • Contribute to attenuation through controlled deletion or modification

  • Serve as a metabolic marker in vaccine strains

This approach aligns with current strategies for S. paratyphi A vaccine development, which include attenuated strains like CVD 1902 (with guaBA and clpX deletions) that have shown promising results in phase 1 clinical trials .

What is the potential role of cobS in developing novel antimicrobial strategies against S. paratyphi A?

The cobS enzyme and the cobalamin biosynthetic pathway offer several promising targets for antimicrobial development:

Pathway-Specific Inhibitors:

  • Design of small molecule inhibitors specifically targeting CobS active site

  • Development of transition-state analogs to block the adenosylcobinamide-GDP ribazoletransferase activity

  • Screening of natural product libraries for selective inhibitors

Cofactor Analogs and Antagonists:

  • Development of cobalamin analogs that compete with natural substrates

  • Design of molecules that disrupt the Co-N bond in the cobalamin cofactor

  • Targeting the unique electronic properties of the cobalt center in cobalamin

Computational studies have revealed that the Co-N axial bond in cobalamin cofactors is particularly vulnerable, with its length typically ranging between 2.30 Å and 2.50 Å . This structural feature could be exploited for targeted drug design.

Combination Approaches:

  • Synergistic targeting of multiple steps in the cobalamin biosynthetic pathway

  • Combining cobS inhibitors with conventional antibiotics

  • Developing prodrugs activated by cobalamin-dependent enzymes

The specificity of the bacterial cobalamin biosynthetic pathway (absent in humans who must obtain vitamin B12 from diet) makes it an attractive target for selective antimicrobial development with potentially minimized side effects.

How can structural and functional studies of cobS contribute to understanding metabolic adaptations in S. paratyphi A?

Structural and functional studies of cobS provide valuable insights into metabolic adaptations of S. paratyphi A in different environments:

Host-Pathogen Interactions:

  • Analysis of cobS expression during different infection stages

  • Understanding cobalamin's role in metabolic adaptations within host environments

  • Correlating cobalamin biosynthesis with virulence factor expression

Environmental Sensing and Regulation:

  • Characterizing the oxygen-dependent regulation of cobS

  • Identifying nutrient signals that influence cobalamin biosynthesis

  • Mapping regulatory networks controlling cobS expression

Studies with S. typhimurium have shown that cobalamin synthesis is only observed under anaerobic conditions , suggesting that oxygen sensing is a critical regulatory mechanism that may be linked to the pathogen's ability to adapt to different host environments.

Metabolic Network Integration:

  • Mapping interactions between cobalamin-dependent enzymes and central metabolism

  • Identifying metabolic bottlenecks affected by cobalamin availability

  • Understanding the energetic costs and benefits of maintaining cobalamin biosynthesis

Research has demonstrated that the biosynthetic pathway has specific requirements, such as early incorporation of cobalt , which may represent adaptations to particular environmental niches or host conditions.

These studies collectively contribute to a systems-level understanding of how S. paratyphi A adapts its metabolism during infection and environmental transitions, potentially revealing new vulnerabilities that could be exploited for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.