Recombinant Salmonella paratyphi A Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; SPA1066; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Target Names
dsbB
Target Protein Sequence
MLRFLNQCSRGRGAWLLMAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLV GAIAPKTPLRYVAMVIWIYSAWRGLQLAYEHTMIQLHPSPFMTCDFMARFPDWLPLGKWL PQVFVASGDCAERQWSFLTLEMPQWLLGIFAAYLVVAIAVVIAQAFKPKKRDLFGR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: spt:SPA1066

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Disulfide bond formation protein B (dsbB) in Salmonella Paratyphi A?

Disulfide bond formation protein B (dsbB) is a membrane-bound oxidoreductase enzyme that functions in the bacterial disulfide bond formation pathway. In Salmonella Paratyphi A, dsbB is encoded by the dsbB gene (locus SPA1066) and plays a critical role in the oxidative protein folding pathway by reoxidizing DsbA, which directly catalyzes disulfide bond formation in nascent proteins in the periplasmic space . The protein consists of 176 amino acids and contains transmembrane domains that anchor it to the inner membrane. DsbB is essential for the proper folding of numerous secreted proteins, including virulence factors, which makes it particularly important for pathogenesis and bacterial survival during infection .

What are the optimal conditions for expressing recombinant Salmonella Paratyphi A dsbB protein?

For optimal expression of recombinant Salmonella Paratyphi A dsbB protein, researchers should consider the following methodological approach:

  • Expression System Selection: Use E. coli BL21(DE3) or similar expression strains optimized for membrane protein expression.

  • Vector Design: Insert the dsbB gene into an expression vector containing:

    • A strong inducible promoter (such as T7)

    • An appropriate fusion tag for purification (6xHis or GST)

    • A signal sequence if periplasmic expression is desired

  • Culture Conditions:

    • Growth temperature: 20-25°C after induction (reduces inclusion body formation)

    • Induction: Use low concentrations of IPTG (0.1-0.5 mM) for slower, more controlled expression

    • Medium: Enriched media such as Terrific Broth supplemented with glucose

  • Membrane Protein Considerations:

    • Add glycerol (5-10%) to the growth medium to stabilize membrane proteins

    • Consider specialized detergents for extraction and purification phases

The expression should be verified using SDS-PAGE and Western blotting with anti-His or antibodies specific to dsbB .

What are the recommended storage conditions for maintaining the stability of purified recombinant dsbB protein?

Based on experimental data, the optimal storage conditions for maintaining the stability and activity of purified recombinant Salmonella Paratyphi A dsbB protein are:

  • Short-term Storage (up to one week):

    • Temperature: 4°C

    • Buffer: Tris-based buffer with appropriate detergent to maintain solubility

    • Avoid repeated freeze-thaw cycles

  • Long-term Storage:

    • Temperature: -20°C for routine storage; -80°C for extended preservation

    • Buffer Composition: Tris-based buffer containing 50% glycerol as a cryoprotectant

    • Aliquot in small volumes to avoid repeated freeze-thaw cycles

  • Storage Buffer Optimization:

    • pH: Maintain at 7.5-8.0 for optimal stability

    • Add reducing agents only if specifically required for the experimental design, as they may interfere with the oxidoreductase activity

    • Consider adding protease inhibitors to prevent degradation

How can recombinant dsbB protein be used in diagnostic assay development for Salmonella Paratyphi A?

Recombinant Salmonella Paratyphi A dsbB protein offers significant potential for diagnostic assay development through several methodological approaches:

  • ELISA-Based Detection Systems:

    • The purified recombinant dsbB can serve as a capture antigen in indirect ELISAs to detect Salmonella Paratyphi A-specific antibodies in patient sera

    • This approach is particularly valuable for seroepidemiological studies and vaccine development assessment

    • Protocol involves coating microplates with purified dsbB, blocking, adding patient sera, and detecting bound antibodies using labeled secondary antibodies

  • PCR-Based Identification Systems:

    • While direct PCR detection targets genomic sequences, recombinant dsbB can be used to generate positive controls

    • The dsbB gene sequence provides specific targets for PCR primer design allowing differentiation between Salmonella serovars

  • Luminescent Serum Bactericidal Assays (L-SBA):

    • Recombinant dsbB can be used to raise antibodies that can be evaluated for functional activity using L-SBA

    • These assays measure the ability of antibodies to induce complement-mediated killing, providing functional data beyond simple binding studies

  • Quality Control Reference Material:

    • Standardized preparations of recombinant dsbB protein can serve as reference standards for assay calibration and validation

The sensitivity and specificity of ELISA assays utilizing recombinant proteins for Salmonella Paratyphi A have shown excellent performance characteristics, with repeatability of approximately 4.4% and intermediate precision of 6.0% in functional assays .

What role does dsbB play in virulence and antimicrobial resistance in Salmonella Paratyphi A infections?

The disulfide bond formation protein B (dsbB) plays critical roles in both virulence and potentially in antimicrobial resistance in Salmonella Paratyphi A:

  • Virulence Factor Maturation:

    • DsbB reoxidizes DsbA, which catalyzes disulfide bond formation in numerous virulence factors

    • Properly folded virulence factors including adhesins, toxins, and secretion system components require functional disulfide bonds

    • The disruption of the DsbB-DsbA redox cascade significantly attenuates bacterial virulence

  • Metabolite Profile Influence:

    • Studies comparing S. Typhi and S. Paratyphi A infections show distinct metabolite profiles during infection

    • These differences may partly result from DsbB's influence on protein folding and subsequent metabolic pathway modulation

    • Specific metabolites like 2,4-dihydroxybutanoic acid, phenylalanine, and pipecolic acid have been found at elevated levels during enteric fever infections

  • Antimicrobial Resistance Connections:

    • The structure and function of several efflux pumps depend on correct disulfide bond formation

    • DsbB's activity may influence the folding and function of proteins involved in antimicrobial resistance

    • The disruption of DsbB function could potentially increase susceptibility to certain antimicrobials

  • Biofilm Formation and Persistence:

    • Properly folded surface proteins dependent on the DsbB-DsbA system are crucial for biofilm formation

    • Biofilms contribute to antimicrobial resistance through physical barriers and altered metabolic states

This multifaceted role makes dsbB an attractive target for antimicrobial development, as inhibiting its function could simultaneously reduce virulence and potentially enhance the effectiveness of existing antibiotics against Salmonella Paratyphi A infections .

How does dsbB from Salmonella Paratyphi A differ from homologous proteins in other Salmonella serovars?

A comparative analysis of dsbB protein across different Salmonella serovars reveals both conservation and meaningful variations:

FeatureS. Paratyphi A dsbBS. Typhi dsbBS. Typhimurium dsbBS. Enteritidis dsbB
Amino acid length176 amino acids176 amino acids176 amino acids176 amino acids
Sequence identity to S. Paratyphi A100%~98%~94%~93%
Active site cysteinesConserved (Cys41, Cys44, Cys104, Cys130)ConservedConservedConserved
Transmembrane domains4 domains4 domains4 domains4 domains
Antigenic regionsSerovar-specific epitopes presentDivergent epitopesDivergent epitopesDivergent epitopes

The sequence variations, particularly in periplasmic loops, can be exploited for developing serovar-specific diagnostic tools, as molecular techniques have already demonstrated the ability to distinguish between Salmonella serovars with high sensitivity and specificity .

What methodologies are most effective for distinguishing between S. Paratyphi A dsbB and related proteins in serological and molecular assays?

Based on research findings, the following methodological approaches are most effective for distinguishing S. Paratyphi A dsbB from related proteins:

  • Multiplex PCR Approaches:

    • Design primers targeting serovar-specific variations in the dsbB gene sequence

    • Multiplex PCR systems can simultaneously detect serogroup D, A, and B Salmonella strains with 100% sensitivity and specificity

    • Methodology includes DNA extraction, PCR amplification with serovar-specific primers, and gel electrophoresis analysis

  • Serovar-Specific Antibody Development:

    • Generate monoclonal antibodies against unique epitopes in S. Paratyphi A dsbB

    • Employ epitope mapping to identify regions of sequence divergence amenable to specific antibody recognition

    • Use competitive ELISA approaches to enhance specificity for S. Paratyphi A

  • Whole-Genome Sequencing and SNP Analysis:

    • More comprehensive approach involves whole-genome sequencing

    • Identifies single nucleotide polymorphisms (SNPs) unique to S. Paratyphi A

    • Methodology includes DNA extraction, library preparation, sequencing, alignment to reference genomes, and SNP identification

    • This approach has superior discriminatory power compared to traditional methods like pulsed-field gel electrophoresis (PFGE)

  • Immunoassay Specificity Enhancement:

    • Pre-absorption of sera with related serovar antigens reduces cross-reactivity

    • Competitive ELISA formats using serovar-specific monoclonal antibodies

    • Luminescent serum bactericidal assays (L-SBA) provide functional discrimination

    • These assays have demonstrated repeatability of 4.4% and intermediate precision of 6.0%

These methodologies collectively provide researchers with robust tools to distinguish S. Paratyphi A dsbB from homologous proteins in other Salmonella serovars with high sensitivity and specificity.

What are the implications of dsbB structural variations for Salmonella Paratyphi A vaccine development?

The structural and functional characteristics of dsbB in Salmonella Paratyphi A have significant implications for vaccine development through several mechanisms:

The development of effective vaccines against S. Paratyphi A remains a critical research priority, especially given the increasing antimicrobial resistance in this pathogen. Understanding dsbB's structure, function, and immunogenicity will be essential for rational vaccine design targeting this pathogen.

How can researchers address the challenges in studying dsbB function in the context of Salmonella Paratyphi A pathogenesis?

Studying dsbB function in Salmonella Paratyphi A pathogenesis presents unique challenges due to the human-restricted nature of this pathogen and the complexity of membrane protein analysis. Researchers can address these challenges through the following methodological approaches:

  • Model System Development:

    • Develop humanized mouse models expressing human-specific receptors

    • Utilize controlled human infection models (CHIMs) for direct study of S. Paratyphi A pathogenesis

    • Employ ex vivo human tissue systems to study host-pathogen interactions in a physiologically relevant context

  • Metabolomic Profiling Approaches:

    • Apply two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS) to identify metabolite signatures associated with dsbB function

    • This approach has successfully distinguished S. Typhi from S. Paratyphi A infections with high accuracy

    • Metabolite profiles can serve as biomarkers for dsbB activity and pathogen identification

  • Genetic Manipulation Strategies:

    • Develop conditional expression systems for dsbB to study its function without complete inactivation

    • Implement CRISPR-Cas9 gene editing for precise genetic modifications

    • Create point mutations in catalytic residues to distinguish between structural and enzymatic roles

  • Functional Assays for Virulence Assessment:

    • Develop high-throughput assays measuring disulfide bond formation in key virulence factors

    • Implement luminescent-based serum bactericidal assays (L-SBA) to assess functional immune responses

    • These assays have demonstrated robust performance characteristics with repeatability of 4.4% and intermediate precision of 6.0%

  • Systems Biology Integration:

    • Combine genomic, transcriptomic, proteomic, and metabolomic data to build comprehensive models of dsbB function

    • Correlate genotypic variations with phenotypic outcomes through machine learning approaches

    • Integrate clinical data from human infections to validate findings from experimental systems

By implementing these methodological approaches, researchers can overcome the inherent challenges in studying S. Paratyphi A pathogenesis and develop a more comprehensive understanding of dsbB's role in infection and immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.