Recombinant Salmonella paratyphi A Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Salmonella Paratyphi A Electron Transport Complex Protein RnfE (rnfE) is a genetically engineered protein component of the Rsx electron transport complex, which plays a critical role in bacterial energy metabolism and redox homeostasis . This protein is encoded by the rnfE gene (locus SSPA1299) and is involved in electron transfer processes, including the reduction of the SoxR transcription factor, a key regulator of oxidative stress responses . Its recombinant form is widely used in biochemical and immunological research to study bacterial pathogenesis and electron transport mechanisms.

Functional Roles in Bacterial Physiology

Electron Transport and Redox Regulation

  • RnfE is a subunit of the Rsx complex, which transfers electrons from NADH to quinones, contributing to the proton gradient required for ATP synthesis .

  • Critical for reducing the SoxR iron-sulfur cluster, enabling Salmonella to counteract oxidative stress during infection .

Pathogenicity

  • While not directly linked to virulence factors like SPI-1/2 effectors , RnfE supports metabolic adaptability under host-induced stress, indirectly influencing bacterial survival .

Recombinant Expression Systems

HostTagExpression DetailsPurity
E. coliHis-tagFull-length protein (1–230 aa), N-terminal fusion≥90%
Cell-Free ExpressionNonePartial or full-length constructs≥85%

Biochemical Studies

  • Used to elucidate the structure-function relationship of the Rsx complex via crystallography and spectroscopy .

  • Serves as an antigen for antibody production in ELISA assays .

Pathogenesis Research

  • Comparative proteomic studies highlight RnfE as part of the conserved core proteome of S. Paratyphi A, underscoring its essential metabolic role .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; SSPA1299; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Salmonella paratyphi A (strain AKU_12601)
Target Names
rsxE
Target Protein Sequence
MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSTLR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links

KEGG: sek:SSPA1299

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Salmonella paratyphi A RnfE?

The most effective expression system for producing recombinant Salmonella paratyphi A RnfE is Escherichia coli, though other systems may be appropriate depending on experimental needs:

Expression SystemAdvantagesLimitationsOptimal Application
E. coliHigh yield, cost-effective, well-established protocolsMay require optimization for membrane proteinsBasic protein characterization, antibody generation
YeastPost-translational modifications, eukaryotic environmentLower yield than E. coliFunctional studies requiring modifications
BaculovirusComplex folding, higher-order assemblyTime-consuming, technically demandingStructural studies, functional assays
Mammalian CellMost sophisticated folding and modificationsExpensive, lowest yieldHost-pathogen interaction studies

For most research purposes, E. coli remains the system of choice due to its balance of yield and ease of use. When expressing RnfE in E. coli, adding an N-terminal His-tag facilitates purification while maintaining protein functionality .

What purification methods yield the highest purity of recombinant RnfE protein?

For recombinant His-tagged RnfE protein, a multi-step purification protocol yields the highest purity:

  • Initial extraction: Use a Tris/PBS-based buffer system with mild detergents to solubilize the membrane-associated protein

  • Affinity chromatography: Ni-NTA agarose works efficiently for His-tagged RnfE purification

  • Size exclusion chromatography: Further separate the target protein from contaminants

  • Ion exchange chromatography: Optional final polishing step

This approach typically achieves >90% purity as determined by SDS-PAGE. For long-term storage, lyophilization in Tris/PBS-based buffer with 6% trehalose (pH 8.0) maintains protein stability .

The purified protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for aliquoting and storage at -20°C/-80°C to prevent degradation through freeze-thaw cycles .

How can researchers confirm the identity and integrity of recombinant RnfE protein?

Researchers should employ multiple complementary methods to confirm recombinant RnfE identity and integrity:

  • Mass spectrometry: Essential for definitive identification and detection of post-translational modifications. This technique has been successfully applied to similar Salmonella proteins .

  • Western blotting: Using antibodies specific to RnfE or the His-tag for immunodetection

  • Peptide mapping: Through tryptic digestion followed by LC-MS/MS analysis

  • N-terminal sequencing: To confirm the correct start of the protein sequence

  • Functional assays: To verify that the recombinant protein maintains its electron transport capability

A comprehensive approach is recommended, as mass spectrometry analysis of Salmonella proteins has demonstrated that many hypothetical proteins are modified post-translationally, which can affect their function .

What are the key differences between RnfE proteins from Salmonella paratyphi A and other Salmonella species?

Comparative analysis reveals subtle but important differences between RnfE proteins across Salmonella species:

SpeciesUniProt IDSequence Identity with S. paratyphi AKey Amino Acid DifferencesFunctional Implications
S. paratyphi AQ5PIC6100%Reference sequenceStandard function
S. TyphiVarious~99%Primarily in variable regionsMinimal functional differences
S. TyphimuriumVarious~95%Additional differences in functional domainsPotentially altered electron transport efficiency
S. gallinarumVarious~93%More substantial differencesMay reflect host adaptation

These differences, though subtle, can be exploited in diagnostic assays for distinguishing between Salmonella serovars in clinical and research settings. The high conservation of the protein across the Salmonella genus reflects its essential role in bacterial metabolism .

What role does the RnfE protein play in Salmonella paratyphi A pathogenicity?

The RnfE protein's contribution to S. paratyphi A pathogenicity is complex and multifaceted:

  • Energy metabolism during infection: As part of the electron transport chain, RnfE helps the bacterium adapt to the host environment by enabling alternative metabolic pathways under oxygen-limited conditions within host tissues.

  • Metabolite profile influence: Studies have shown that different Salmonella species produce distinct metabolite profiles during infection. The electron transport chain components, including RnfE, contribute to these metabolic signatures that can differentiate S. Typhi from S. Paratyphi A infections .

  • Survival under stress: The Rnf complex helps maintain redox balance during host-induced oxidative stress.

Research has demonstrated that metabolomic analysis can identify six specific metabolites that accurately distinguish between S. Typhi and S. Paratyphi A infections, suggesting that differences in proteins like RnfE contribute to these distinct metabolic signatures .

How can recombinant RnfE be used in advanced Salmonella genotyping and surveillance?

Recombinant RnfE protein can be strategically employed in advanced Salmonella surveillance:

  • Antibody development: Recombinant RnfE can be used to produce specific antibodies for immunodetection assays.

  • Integration with genomic surveillance: The RnfE gene (rsxE) contains informative SNPs that can be incorporated into genotyping schemes. Recent genomic surveillance tools like "Paratype" have segregated S. Paratyphi A populations into three primary and nine secondary clades across 18 genotypes .

  • Metabolomic fingerprinting: The activity of electron transport proteins like RnfE influences the metabolite profiles that can distinguish between Salmonella serovars with high specificity .

Combining protein-based approaches with genomic surveillance provides comprehensive monitoring of S. Paratyphi A transmission. The "Paratype" genotyping scheme specifically identified SNPs in genes like SPA_RS02955, SPA_RS20855, and SPA_RS11495 that can reliably identify different lineages of S. Paratyphi A .

What methodologies are most effective for studying RnfE protein interactions with host systems?

For studying RnfE interactions with host systems, researchers should consider these methodologies:

  • Human challenge models: Experimental infection in volunteers provides critical insights into host-pathogen interactions. Such models have been developed for S. Paratyphi A using the NVGH308 strain .

  • Two-dimensional gas chromatography with time-of-flight mass spectrometry (GCxGC/TOFMS): This technique has successfully identified 695 individual metabolite peaks in plasma from patients with S. Paratyphi A infections, revealing serovar-specific systemic biomarkers .

  • Protein-protein interaction assays:

    • Co-immunoprecipitation with host factors

    • Yeast two-hybrid screening

    • Proximity-dependent biotin labeling (BioID)

  • Structural biology approaches:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR spectroscopy for membrane protein dynamics

These methodologies help overcome challenges posed by the human-restricted nature of S. Paratyphi A and the lack of small animal models for studying this pathogen .

How does RnfE compare to other electron transport complex proteins as potential diagnostic or vaccine targets?

RnfE has several characteristics that influence its potential as a diagnostic or vaccine target:

ProteinMembrane ExposureConservationImmunogenicityDiagnostic PotentialVaccine Potential
RnfEModerateHighMediumModerateUnder investigation
Vi capsule proteinsHighVariableHighHighProven (Vi vaccines)
Flagellar proteinsHighVariableVery highHighPromising
Outer membrane proteinsHighVariableHighHighUnder investigation

While RnfE is not currently a primary target for vaccine development, its high conservation makes it useful for diagnostics. The distinct metabolic profiles associated with electron transport proteins like RnfE can distinguish between S. Typhi and S. Paratyphi A infections with high accuracy .

What are the primary challenges in expressing and purifying functional RnfE protein, and how can they be overcome?

Researchers face several challenges when working with RnfE:

  • Membrane protein solubility: As a membrane-associated protein, RnfE can be difficult to solubilize while maintaining its native conformation.

    • Solution: Use mild detergents (DDM, LDAO) and optimize buffer conditions (pH 7.5-8.0, 150-300 mM NaCl).

  • Protein degradation: RnfE can be susceptible to proteolytic degradation during expression and purification.

    • Solution: Add protease inhibitors throughout the purification process and work at reduced temperatures (4°C).

  • Proper folding: Ensuring correct folding of the recombinant protein.

    • Solution: Consider using specialized E. coli strains (C41/C43) designed for membrane protein expression or explore alternative expression systems.

  • Aggregation during storage: RnfE may aggregate during storage, particularly after freeze-thaw cycles.

    • Solution: Store in Tris/PBS buffer with 6% trehalose at pH 8.0, add 5-50% glycerol, and avoid repeated freeze-thaw cycles .

Successful purification typically achieves >90% purity as determined by SDS-PAGE, with yields of 2-5 mg per liter of culture when expressed in E. coli .

How can researchers use RnfE to differentiate between Salmonella Paratyphi A and other closely related pathogens?

RnfE can be utilized in several approaches to differentiate S. Paratyphi A from related pathogens:

  • SNP analysis: The rsxE gene contains specific single nucleotide polymorphisms that differ between Salmonella serovars. PCR-based assays targeting these SNPs can provide rapid identification .

  • Metabolomic fingerprinting: The electron transport chain influences bacterial metabolism. GCxGC/TOFMS analysis of plasma from infected patients has revealed that a combination of just six metabolites can accurately define the etiological agent between S. Typhi and S. Paratyphi A .

  • Immunological approaches: Antibodies raised against recombinant RnfE can detect subtle differences in protein epitopes between serovars.

  • Genomic context analysis: While modern genomic surveillance tools like "Paratype" can segregate S. Paratyphi A into distinct lineages, protein-based approaches provide complementary information .

This multi-modal approach is especially valuable since S. Typhi and S. Paratyphi A cause clinically indistinguishable diseases but may respond differently to treatments, particularly as antimicrobial resistance emerges .

What are the emerging applications of recombinant RnfE in systems biology approaches to understanding Salmonella pathogenesis?

Emerging systems biology applications for recombinant RnfE include:

  • Integration with multi-omics data: Combining proteomics, metabolomics, and genomics to develop comprehensive models of Salmonella metabolism during infection. Research has demonstrated that metabolomic analysis can identify specific metabolites that distinguish between S. Typhi and S. Paratyphi A infections .

  • Network analysis: Mapping the interactome of RnfE within both bacterial and host systems to identify critical nodes for intervention.

  • Machine learning approaches: Using protein features and expression patterns to predict virulence and antimicrobial resistance.

  • Synthetic biology applications: Engineering modified RnfE variants to study the effects of specific mutations on bacterial fitness and pathogenicity.

These approaches are particularly valuable as S. Paratyphi A infections represent approximately one-quarter of the estimated 20 million cases of enteric fever annually, with rising antimicrobial resistance and no licensed vaccines currently available .

How might structural analysis of RnfE contribute to novel antimicrobial development?

Structural analysis of RnfE offers promising avenues for antimicrobial development:

  • Structure-based drug design: Detailed structural information can identify potential binding pockets for small molecule inhibitors that could disrupt electron transport.

  • Comparative structural analysis: Identifying structural differences between human and bacterial proteins to ensure selective targeting.

  • Rational attenuation for vaccine development: Structural insights could guide the creation of attenuated strains with modified RnfE function for potential vaccine candidates.

  • Combination therapy approaches: Understanding how RnfE inhibition might sensitize bacteria to existing antibiotics.

This approach is especially relevant as enteric fever affects an estimated 3.4 million people annually and causes approximately 19,100 deaths globally, with increasing antimicrobial resistance presenting a major challenge .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.